KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_2229Help
Entry
BLIJ_2229         CDS       T02092                                 

Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
blon00010  Glycolysis / Gluconeogenesis
blon00260  Glycine, serine and threonine metabolism
blon00680  Methane metabolism
blon01100  Metabolic pathways
blon01110  Biosynthesis of secondary metabolites
blon01120  Microbial metabolism in diverse environments
blon01130  Biosynthesis of antibiotics
blon01200  Carbon metabolism
blon01230  Biosynthesis of amino acids
Module
blon_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLIJ_2229
  Energy metabolism
   00680 Methane metabolism
    BLIJ_2229
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLIJ_2229
Enzymes [BR:blon01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BLIJ_2229
Membrane trafficking [BR:blon04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BLIJ_2229
Exosome [BR:blon04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BLIJ_2229
  Exosomal proteins of melanoma cells
   BLIJ_2229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAJ69806
UniProt: B7GUR7
Position
complement(2377480..2378220)
Genome map
AA seq 246 aa AA seqDB search
MTYKLVLLRHGQSAWNKTNQFTGWVDVPLTEQGEAEAKRGGELLKEKNVLPDIVFTSLLR
RAINTANIALDAADRLWIPVQRDWRLNERHYGALQGKNKTEIREEYGDEKFMLWRRSYAT
PPPEIDPNDQYAQNNDPRYAGDPVPEAECLANVVERVKPYFESAIEPELKAGKTVLIAAH
GNSLRAIVKMLDNLSEEEIAKVNIPTAIPLLYELDENFKPIKPRGEYLDPEAAAAGAAAV
AAQGQK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaaactagtactgctccgtcatggacagagcgcatggaataaaaccaaccag
ttcaccggctgggtcgacgtaccgctgaccgagcagggtgaagccgaagccaagcgtggc
ggcgagctgctcaaggagaagaacgtccttccggacattgtgttcacctccctgctgcgt
cgcgccatcaataccgccaacatcgctctggatgccgcagatcgtctgtggatcccggtt
cagcgtgactggcgtctcaacgagcgtcactacggcgctctgcagggcaagaacaagacc
gagatccgcgaagagtacggcgatgagaagttcatgctgtggcgccgttcttacgccacc
ccgccgcccgagatcgacccgaacgaccagtacgcccagaacaacgacccgcgctatgcc
ggcgatccggttccggaagccgagtgcctggccaacgttgttgagcgtgtgaagccgtac
ttcgagtccgctatcgagccggagctcaaggccggaaagaccgtgctgattgctgcccac
ggcaactccctccgcgccatcgtcaagatgctggacaacctgtctgaggaagagatcgcc
aaggtcaacatcccgaccgccatcccgctgctttatgagctggacgagaacttcaagccg
atcaagccgcgtggcgagtacctggacccggaggctgctgctgccggtgccgctgctgtc
gccgctcagggccagaagtga

DBGET integrated database retrieval system