KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_2313Help
Entry
BLIJ_2313         CDS       T02092                                 

Definition
(GenBank) aldehyde-alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
blon00010  Glycolysis / Gluconeogenesis
blon00071  Fatty acid degradation
blon00350  Tyrosine metabolism
blon00620  Pyruvate metabolism
blon00625  Chloroalkane and chloroalkene degradation
blon00626  Naphthalene degradation
blon00650  Butanoate metabolism
blon01100  Metabolic pathways
blon01110  Biosynthesis of secondary metabolites
blon01120  Microbial metabolism in diverse environments
blon01130  Biosynthesis of antibiotics
blon01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLIJ_2313
   00620 Pyruvate metabolism
    BLIJ_2313
   00650 Butanoate metabolism
    BLIJ_2313
  Lipid metabolism
   00071 Fatty acid degradation
    BLIJ_2313
  Amino acid metabolism
   00350 Tyrosine metabolism
    BLIJ_2313
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BLIJ_2313
   00626 Naphthalene degradation
    BLIJ_2313
Enzymes [BR:blon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BLIJ_2313
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BLIJ_2313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 Phage_holin_3_6
Motif
Other DBs
NCBI-ProteinID: BAJ69890
Position
complement(2469881..2472610)
Genome map
AA seq 909 aa AA seqDB search
MAEAKKKVEAAKPTPEEKRAAAEAEVDALVARAKKALDEFENLDQKQVDRIVAKASIAAL
NKHLVLAKMAVDETGRGLVEDKATKNIFACEHVTNYLAGQKTVGIIREDDVMGIDEVAEP
VGVVAGVTPVTNPTSTAIFKSLIALKTRCPIIFGFHPGAQKCSIEAAKIVRDAAIEAGAP
ENCIQWIEHPSIQATGALMQHPGVATILATGGPGMVKAAYSSGKPALGVGAGNAPAYVDS
DVDIVRAANDLVLSKHFDYGMICATEQAIIAHKDVYDQLIKELKVRKAYFVNAEEKAKLE
QYMFGCAAGSGVKPVLNSVVPGKSPQFIAKAAGFEIPADATILAAECKEVSDDEPLTHEK
LAPVQAVLKADDKEQAFEMCEKMLKLGAGHTAAIHTNNQELVREYGVRMHACRIIWNQPS
SLGGIGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLVNIKRIARRNNNMQWFKIPAKTY
FEPNAIKYLRDMYGIEKAVIVCDKVMEQLGIVDKVIDQLRARSNRVTFRIIDYVEPEPSV
ETVEKGAEMMREEFEPDTIIAVGGGSPMDASKIMWLLYEHPEIAFSDVREKFFDIRKRAF
KIPPLGKKAKLVCIPTSSGTGSEVTPFAVITDHKTGYKYPITDYALTPSVAIVDPVLART
QPRKLASDAGFDALTHSMEAYVSVYANDFTDGMALHAAKLIWDNLAESVNGEPGLAKTDA
QEKMHNAATMAGMAFGSAFLGMCHGMAHTIGALCHIAHGRTNSILLPYVIRYNGQIPEEP
TSWPKYNKYIAPERYQDIARNLGIDTGKTPAEAVENLAKAVEDYRDNKLGMNKSFQDCGV
DEDYFWSVLDQIGMRAYEDQCTPANPRIPLINDMKDIAVGAYYGVSQAEGHKLRIEREGE
AATEEASER
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaagcaaagaagaaggtcgaagccgccaagccgaccccggaagagaagcgggcc
gcagctgaggccgaggttgacgcgctggttgcccgtgccaagaaggctctcgacgaattc
gagaacctcgaccagaagcaagttgaccgtatcgtcgccaaggcctccatcgccgctctg
aacaagcacctcgttctcgccaagatggctgtcgacgagaccggccgtggtctcgtggaa
gacaaggccaccaagaacatcttcgcctgtgagcacgtcaccaactacttggccggccag
aagaccgtcggcatcatccgtgaagacgacgtgatgggcatcgatgaggtcgccgagccc
gtcggcgtggtagccggcgtcactccggttaccaacccgacctccaccgccatcttcaag
tccctcatcgccctgaagacacgctgcccgatcatcttcggcttccaccccggcgcgcag
aagtgctccatcgaggccgccaagattgtgcgcgacgccgccattgaggccggtgctccc
gagaactgtatccagtggatcgagcacccgtccatccaggccaccggcgcgctgatgcag
cacccgggcgtggccacgatcctcgccaccggtggtccgggcatggtcaaggccgcttac
tcctccggcaagcccgccctcggcgtgggtgccggcaacgccccggcctatgttgattcc
gatgtggacatcgtgcgtgccgccaacgatctggtgctctccaagcacttcgattacggc
atgatctgcgccaccgagcaggccatcatcgcccacaaggacgtctacgaccagctcatc
aaggagctcaaggtccgtaaggcctacttcgtcaacgccgaagagaaggccaagctggaa
cagtacatgttcggctgcgccgccggctccggcgtcaagcccgtgctgaactccgtggtg
ccgggcaagtccccgcagttcatcgccaaggccgccggcttcgagattccggccgacgcc
accattctggccgccgagtgcaaggaagtctccgacgacgagccgctgacccacgagaag
ctcgctccggtgcaggccgtgctcaaggccgacgacaaggagcaggccttcgagatgtgc
gagaagatgctcaagctgggtgccggccacaccgccgccatccacaccaacaaccaggag
ctcgtgcgtgagtacggcgtccgtatgcacgcctgccgcatcatctggaaccagccttcc
tcccttggcggcatcggcgacatctacaacgccatcgccccgtcgctgaccctgggctgc
ggctcctacggcggcaactcggtgtccggcaacgtgcaggccgtgaatctcgttaatatc
aagcgcattgctcggaggaacaacaacatgcagtggttcaagatcccggccaagacatac
ttcgagccgaacgccatcaagtacctgcgcgacatgtacggcatcgagaaggccgtcatc
gtgtgcgataaggtcatggaacagctcggcattgtcgacaaggtcatcgaccagctgcgc
gcccgctccaaccgtgtgaccttccgcatcatcgactacgtcgagccggagccctccgtc
gagaccgtcgaaaagggcgctgagatgatgcgcgaggagttcgagccggacacgatcatc
gcggtcggcggcggctccccgatggacgcctccaagatcatgtggctgctctacgagcac
ccggaaatcgccttctccgacgtgcgcgagaagttcttcgatatccgtaagcgcgcgttc
aagatcccgccgctgggcaagaaggccaagctcgtgtgcatcccgacctcctccggcacc
ggctccgaggtcaccccgttcgccgtgatcaccgatcacaagaccggctacaagtacccg
atcaccgactacgcgctgaccccgtccgtggccatcgtggacccggtgctggctcgcacc
cagccgcgcaagctggcctccgacgccggcttcgacgccctgacccactcgatggaagcc
tacgtgtccgtgtacgcgaacgacttcaccgacggcatggccctgcacgcggccaagctc
atctgggacaacctggctgagtccgtcaacggcgagcccggcctggccaagaccgacgct
caggagaagatgcacaacgccgccaccatggccggcatggcattcggctccgcgttcctc
ggcatgtgccacggcatggcccacaccatcggtgccctatgccacatcgcccacggccgc
accaactccatcctgctgccgtacgtgattcgctacaacggccagattcctgaggagccc
acctcttggccgaagtacaacaagtacatcgccccggagcgctaccaggacatcgcccgc
aacctcggcatcgacaccggcaagaccccggccgaagccgtggagaacctggcgaaggcc
gtcgaggactaccgcgacaacaagctcggcatgaacaagagcttccaggattgcggcgtg
gacgaggactacttctggtccgtgctcgatcagatcggcatgcgcgcctacgaggaccag
tgcaccccggccaacccgcgcatcccgctgatcaacgacatgaaggacatcgccgtcggt
gcctactacggcgtctcccaggcggaaggccacaagctgcgcatcgagcgcgagggcgag
gccgccactgaggaagcctccgagcgctga

DBGET integrated database retrieval system