KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_2377Help
Entry
BLIJ_2377         CDS       T02092                                 

Definition
(GenBank) dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
blon00300  Lysine biosynthesis
blon01100  Metabolic pathways
blon01120  Microbial metabolism in diverse environments
blon01230  Biosynthesis of amino acids
Module
blon_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BLIJ_2377
Enzymes [BR:blon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BLIJ_2377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: BAJ69954
Position
complement(2556187..2557461)
Genome map
AA seq 424 aa AA seqDB search
MYSAAKSHVVGVLGPPPTRYAGHMTLELNRTASTAEQLNSLLTQIMENFSVSDHEGPLTD
EAEAFLGGQEHLTVRRHGDTVVASTDFGKPSRVILAGHLDTVPVIDNFPPKWLEPGDSLI
REEIAHAHPEDRVLWGRGATDMKASDAVMLYLAATLDGLTPETTPKVDLTYVFYDHEEVV
AEKNGLRKVVEAHPDWITGDFAIIGEPTNSGIEGGCNGTIRFDVVTHGVAAHSARAWMGE
NAIHKAADILNRLNTYEPATVNVDGLDYREGLNATLISGGKGTNVIPDECRVHVNYRFAP
DKSLAEAKALMMGADAGAELGNGEHVATGGVFEDYGIEMKDESPSARPGLNAPLAQDLVR
LVKERTGRDPLAKLGWTDVARFSQLGIPAVNLGAGDPLLAHKHDEQVPESDLTAMAAILT
DWLV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtattcggccgcaaaatctcatgtagtgggtgtgctgggcccgccgcccacgcggtac
gctggtcacatgacgcttgaattgaaccgcaccgcatccactgccgagcagctgaacagc
ctgctcacccagatcatggagaacttctccgtgtccgaccacgagggccccctcaccgac
gaggctgaggccttcctgggcgggcaggaacacctgaccgtccgtcgtcacggtgacaca
gtggtggccagcaccgacttcggcaagccgagccgtgtgatcttggccgggcacctcgat
actgtgccggtcatcgacaatttcccaccaaagtggctggagcccggcgattcgctgatt
cgcgaagaaatcgcccacgctcatcccgaagaccgcgtgctgtggggccgcggtgccacc
gatatgaaggcctccgacgcagtgatgctctaccttgccgccacgctcgacggcctcacg
ccggaaaccaccccgaaagtcgacctcacctacgtcttctacgaccatgaggaagtcgtc
gccgaaaagaatggcctacgcaaagtcgtcgaggcccatcccgattggatcaccggcgat
ttcgccatcatcggcgaacccaccaacagcggcatcgagggcggctgcaacggcacgatt
cgcttcgacgtcgtgacccacggcgtggccgcccactccgcccgcgcgtggatgggggag
aacgccatccacaaggcggccgacattctgaaccgactcaacacctacgagccggccacc
gtgaacgtggacgggctcgactatcgcgagggcctcaacgccactctgatctccggcggc
aaaggcacgaacgtcattccggatgaatgccgcgtgcacgtcaactaccgcttcgccccg
gacaagtcgctggccgaggccaaagccctgatgatgggcgcggacgccggtgccgaactc
ggcaatggcgagcatgtggccaccggcggcgtgttcgaggactacggcatcgaaatgaag
gacgaaagcccttccgcgcgcccgggtctgaacgccccgctcgcccaggatctggtccga
ctggttaaggagcgcactggccgcgacccactggccaagctcggctggaccgacgtggca
cgcttctctcagctcggtatcccggccgtcaacctcggtgccggcgatccgctgctggct
cacaagcacgacgagcaggtgcccgaatccgatctgaccgccatggccgcaatccttacc
gactggctggtctga

DBGET integrated database retrieval system