KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_2377Help
Entry
BLIJ_2377         CDS       T02092                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:blon01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:blon00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2556187..2557461)
Genome map
AA seq 424 aa AA seqDB search
MYSAAKSHVVGVLGPPPTRYAGHMTLELNRTASTAEQLNSLLTQIMENFSVSDHEGPLTD
EAEAFLGGQEHLTVRRHGDTVVASTDFGKPSRVILAGHLDTVPVIDNFPPKWLEPGDSLI
REEIAHAHPEDRVLWGRGATDMKASDAVMLYLAATLDGLTPETTPKVDLTYVFYDHEEVV
AEKNGLRKVVEAHPDWITGDFAIIGEPTNSGIEGGCNGTIRFDVVTHGVAAHSARAWMGE
NAIHKAADILNRLNTYEPATVNVDGLDYREGLNATLISGGKGTNVIPDECRVHVNYRFAP
DKSLAEAKALMMGADAGAELGNGEHVATGGVFEDYGIEMKDESPSARPGLNAPLAQDLVR
LVKERTGRDPLAKLGWTDVARFSQLGIPAVNLGAGDPLLAHKHDEQVPESDLTAMAAILT
DWLV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtattcggccgcaaaatctcatgtagtgggtgtgctgggcccgccgcccacgcggtac
gctggtcacatgacgcttgaattgaaccgcaccgcatccactgccgagcagctgaacagc
ctgctcacccagatcatggagaacttctccgtgtccgaccacgagggccccctcaccgac
gaggctgaggccttcctgggcgggcaggaacacctgaccgtccgtcgtcacggtgacaca
gtggtggccagcaccgacttcggcaagccgagccgtgtgatcttggccgggcacctcgat
actgtgccggtcatcgacaatttcccaccaaagtggctggagcccggcgattcgctgatt
cgcgaagaaatcgcccacgctcatcccgaagaccgcgtgctgtggggccgcggtgccacc
gatatgaaggcctccgacgcagtgatgctctaccttgccgccacgctcgacggcctcacg
ccggaaaccaccccgaaagtcgacctcacctacgtcttctacgaccatgaggaagtcgtc
gccgaaaagaatggcctacgcaaagtcgtcgaggcccatcccgattggatcaccggcgat
ttcgccatcatcggcgaacccaccaacagcggcatcgagggcggctgcaacggcacgatt
cgcttcgacgtcgtgacccacggcgtggccgcccactccgcccgcgcgtggatgggggag
aacgccatccacaaggcggccgacattctgaaccgactcaacacctacgagccggccacc
gtgaacgtggacgggctcgactatcgcgagggcctcaacgccactctgatctccggcggc
aaaggcacgaacgtcattccggatgaatgccgcgtgcacgtcaactaccgcttcgccccg
gacaagtcgctggccgaggccaaagccctgatgatgggcgcggacgccggtgccgaactc
ggcaatggcgagcatgtggccaccggcggcgtgttcgaggactacggcatcgaaatgaag
gacgaaagcccttccgcgcgcccgggtctgaacgccccgctcgcccaggatctggtccga
ctggttaaggagcgcactggccgcgacccactggccaagctcggctggaccgacgtggca
cgcttctctcagctcggtatcccggccgtcaacctcggtgccggcgatccgctgctggct
cacaagcacgacgagcaggtgcccgaatccgatctgaccgccatggccgcaatccttacc
gactggctggtctga

DBGET integrated database retrieval system