KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_2396Help
Entry
BLIJ_2396         CDS       T02092                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BLIJ_2396
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BLIJ_2396
Enzymes [BR:blon01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BLIJ_2396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2579179..2580504)
Genome map
AA seq 441 aa AA seqDB search
MAENPDDVLHVEGGKPLAGTIKVRGAKNFVSKAMVAALLAPGKSVLKNVPEIRDVHVVSD
LLRLHGVDVDVDGEKGIVTIDASHVQLADVADVDTLSGSSRIPILFSGPLVHRLGEAFIP
ALGGCAIGGRPIDFHLETLRKLGATVDKEHKDGIHITAPNGLHGAKIHLPYPSVGATEQT
LLAAVLAEGKTELSGAATEPEIMDLVCVLQKMGAIISVDVDRTFRIEGVKELQGYTHTSL
TDRIEAASWASAALATHGDIFVKGATQPEMITFLNVFRKVGGKFEVTDKGIRFWHPGGDL
KPVAIETDVHPGFMTDWQQPLVVALTQANGLSIVHETVYENRFGFTKPLVEMGATIQLYR
ECLGSLPCRFRQRNYKHSAVIFGPTPLTGRDIDVPDLRGGFSHLIAALAASGPSDVHGIS
LIDRGYADFRGKLEALGADFD
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagaacccggatgacgtgctgcatgttgaaggcggcaagccgctggctggcacg
attaaggtgcgcggcgcgaagaacttcgtgagcaaggcgatggtcgccgcgttgctggcg
ccgggcaagtcggtgctgaagaacgtgccggagatccgtgacgtgcatgtggtgtccgat
ttgctgcgcctgcatggcgtggacgtggatgtggacggcgaaaagggcattgtgactatc
gatgcctctcatgttcagctggccgatgtggctgacgtggacacgctgtctggctcctcg
cgcatcccgatcctgttctccggcccgctggtgcaccgtctgggcgaggcgttcatcccc
gcactcggcggctgcgcgatcggcgggcgcccgatcgacttccatttggagacgctgcgc
aagctgggcgccacggtggacaaggagcacaaggacggcatccacatcaccgcgcccaac
ggcctgcacggcgcgaagatccacctgccctacccgtcggtgggcgccaccgagcagacg
ctgctggcggccgtgctggccgagggcaagaccgaactgtcgggcgcggccaccgagccg
gagatcatggatttggtatgcgtgctgcagaagatgggcgcgattatttccgtggacgtg
gaccgcaccttccgcattgaaggcgtcaaggagctgcaaggctacacgcacacgtcgctg
accgaccgtatcgaggccgcgtcctgggcgtccgccgcgcttgccacgcacggcgacatc
ttcgtcaagggagcgacccagccggagatgatcacgttcctgaacgtgttccgcaaggtg
ggcggcaagttcgaggtgacggacaagggcatccgcttctggcatccgggcggcgacttg
aagcccgtggctatcgagaccgacgtgcaccctggcttcatgaccgactggcagcagccg
ctcgtggtggccctgacgcaagccaatggcctgtcgattgtgcacgagaccgtgtatgag
aaccgctttggctttaccaagccgctggtcgagatgggtgccaccatccagttgtaccgc
gagtgcctgggctcgctgccgtgccgtttccggcagcgcaactacaagcattccgccgtg
atcttcggaccgaccccgctgaccggacgcgacatcgacgtgccggacctgcgtggtggg
ttcagccatctgatcgcggccttggccgcgtccggcccctcggacgtgcacggcatcagc
ctgatcgaccgaggctacgccgacttccgaggcaaactcgaagccctcggcgccgacttc
gactaa

DBGET integrated database retrieval system