KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_2472Help
Entry
BLIJ_2472         CDS       T02092                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:blon01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:blon00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:blon00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:blon00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:blon00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:blon00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2682569..2683708
Genome map
AA seq 379 aa AA seqDB search
MTDGSRRRCRTRRKPDNNKSGGELTQCSRPYRLITPTEMPMSFASIIHQHTVISVDIGGT
KIAAGLMCVDLDEQGRPRDMPALIRRYVIPTKARLGGTSVLQRVVQAIRQCLDDGEIPFP
LLGIGVASAGVIDGNGSVVSATSLIPGWAGIQLQAELSATFNVPAIVIGDVQAHALGEAH
WGCGRQYQSLLVAAIGTGIGGAIIIDGKLVRGVHGACGHIGHLPHPDAIGISCSCGCEGH
VESIASGTGIADNYRRALQQNGHNTLPTDINGRAIAELASQGSTEAVTSITLAGTSLGDV
LGGLINALDPDAVILSGSVVHSGELWMKSVKQGIQRQTLGILSRTPVLTGTLGGRAPLIG
ATSALCADLRSNKEQKYEY
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatggttcaaggcgtcgttgtcgtactcggaggaagcctgataacaataaaagc
ggaggcgaactgacgcagtgcagtcgcccataccgcttaatcacaccaacggagatgcct
atgagttttgcaagcataatccatcagcatacggtgatatccgtggacatcggcggcacc
aaaatcgccgctggtctcatgtgcgtagacctcgacgaacaaggaagaccgcgggacatg
ccagcgttgattcgacggtacgtcataccgacgaaagcacgtctcggcggcacctccgta
ttgcaacgcgtcgttcaagccattcgccagtgtctggacgatggtgagattcctttccca
ctattggggatcggtgtagcgagcgcaggagtcattgacggcaacggttcggtggtatca
gccacttcgttgattcccggttgggccggtattcaactgcaagccgaattatcggcaacg
ttcaacgtgcctgccatcgtcatcggagatgttcaggcacacgcccttggtgaagcgcac
tggggatgcggacgacaataccaatcactactggtcgccgccatcggcaccggtatcgga
ggcgcgataatcatcgacgggaaactggtacgcggcgtccacggagcctgtggccatatc
ggccatctgccgcatcccgacgccattggtatatcctgctcatgtggatgtgagggccat
gtggagtcaatcgcctcaggtaccggcattgccgataattatcgacgtgctctgcaacag
aacggacacaatactctccccaccgacatcaatggacgcgctatcgccgaactggccagt
caaggtagtacggaagccgtaaccagtatcactctggccggcacgagtctcggcgatgtt
cttggcggactaatcaatgcccttgatcccgatgccgtgatcctttccggctccgtagtc
cattctggagagctatggatgaaatctgtgaaacaaggcatccaaagacagaccttgggc
attctttcccgaacaccggttttgacaggaacactcggcggcagagcccctctcatcgga
gcaacatcagctctgtgcgccgacctcagatcaaataaggagcagaaatatgaatactaa

DBGET integrated database retrieval system