KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_2531Help
Entry
BLIJ_2531         CDS       T02092                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BLIJ_2531
  Lipid metabolism
   00561 Glycerolipid metabolism
    BLIJ_2531
   00600 Sphingolipid metabolism
    BLIJ_2531
Enzymes [BR:blon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BLIJ_2531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2773542..2775845)
Genome map
AA seq 767 aa AA seqDB search
MAENTSTFTGAAADGTALTAVYLTQPAANVAIGLVFAGSDLPRIVHWGRPLAKPDTLLAA
YDALKPQRVSGALDDTAWPSILPTQAESWIGEQRVVLRRAGVELFPKFTVTNIEAGGVLE
ATLDAVSGESYTDVAGHARATGPVRVPGVIVTARDEEQGVEVEWHLELLPGGLVRQKATV
TNLFGADAGAPLEIGKIELGFPLPESAGEILTTTGHHLRERSPQRQPLTVGRFEKPQLAG
RPDFDASLLLTAGVPGFGFEHGDAYSVHVGWSGNSVLSAERLPYTTGVIGGGELLFGGEV
TLAGPGEGQNSYDTPWLFGSYGDGLNEIAARFHSYVRSLHPRLFSHGRPVILNTWEAVYF
DHNFDTLKALADKAADSGVERFVVDDGWFGSRRDDTSGLGDWQIAQDVWPDGPKSLKALA
DYVHAKGMEFGLWFEPEMVNPDSDVARNHPDWILSPTAGRLPLQGRTQQVLDLTNPDAFD
YIYGCMDQLVGELGIDYIKWDHNKLVTEPGSRRSGRPAVHAQTLAVYNIFKGLKTAHSGL
EIESCSSGGGRVDLGILEHADRIWVSDCVDPVERADIQRYTSLLVPPAMMGEHVGASPAH
STQRATSQELRMAMAFFGHMGIEWNLLKEPDEALAKLAVWVAEFKKHRDWFAIDTCVHAD
SNDPAVRLDGMVMPNRDAAIYRFTQLTTSQTYPAAPVHLPGLDPERTYRVSPLDPSLDLT
GLTNGQSTLGWWNEEGVVLTGEALQRYGIRPPSLHPQQAVLFKAVAE
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacacctccactttcaccggtgccgccgctgacggtaccgcactcaccgcc
gtctacctgacccagcccgccgccaatgtggcgatcggtctggtgtttgccggcagcgac
ctgccgcgcatcgtccactggggtcgcccgctggccaagcccgacaccctgctggccgcc
tatgacgccctgaagccgcagcgcgtgtccggcgcgctcgacgacaccgcttggccgtcc
atcctgcccacccaggccgaaagctggatcggcgagcagcgcgtggtgctgcgccgcgcc
ggcgtcgagctcttccccaagttcaccgtgaccaatatcgaggccggcggcgtgctggaa
gccaccctcgatgccgtgtccggcgaaagctacaccgatgtggccggccatgcccgtgcc
accggtccggtccgcgtgcccggcgtcatagtcaccgcgcgcgatgaggagcagggcgtg
gaagtcgagtggcacctcgaactgctccccggcggcctggtccgtcagaaggccaccgta
accaacctgttcggtgcagacgccggagccccgctcgagatcggcaagatcgagctcggc
ttcccgctgcccgaatccgccggcgaaatcctcaccaccaccggtcaccatctacgtgaa
cgcagtccgcagcgccagccgctgaccgtcggccgtttcgaaaagccgcagctcgccggc
cgccctgacttcgacgcatccctgctcctgaccgccggcgtgcccggtttcggcttcgag
catggcgacgcctattcggtgcacgtgggctggagcggcaactccgtactgtccgccgaa
cgtctgccctacacgaccggcgtaatcggcggcggcgaactcctgttcggcggcgaagtg
acgctcgccggccccggcgaaggccagaactcctacgacaccccgtggctgttcggctcc
tatggcgatggcctcaatgagatcgccgcccgcttccactcctacgtgcgctccctgcat
ccgcgcctgttctcgcacggccgtccggtgatcctcaacacctgggaagctgtgtacttc
gaccacaacttcgatacgctgaaggcgctcgccgacaaggccgccgactccggcgtggaa
cgattcgtggtggatgacggttggttcggttcccgccgcgacgacacctccggcctcggt
gactggcagattgcgcaggacgtctggcccgatggcccgaagtccctgaaggcgctcgcc
gactacgtgcacgccaagggtatggaattcggcttgtggttcgagccggaaatggtcaac
cccgattccgatgtggcccgtaaccaccccgattggattctctcgcccactgccggccgt
ctgccgctgcagggccgcactcagcaggtgctcgatctgaccaatccggatgcgttcgac
tacatctacggctgcatggaccagcttgtcggcgagcttggtatcgattacatcaagtgg
gaccacaacaagctcgtcaccgagcccggttcccgccgctccggccgcccggccgtgcac
gcgcagacccttgccgtctacaacatcttcaagggcctcaagaccgcacattcgggcctt
gagatcgaaagctgctcctctggtggcggccgcgtggatcttggcatcctagagcacgcc
gatcgtatctgggtctccgactgcgtggacccggtcgagcgcgcggacatccagcgctac
acctcgctgctggtgccgccggcgatgatgggcgagcacgtgggcgccagtcccgcgcac
tccacccagcgtgccaccagccaggaactgcgcatggccatggcgttcttcggccacatg
ggcatcgaatggaacctgttgaaggagccggacgaggcgctcgccaagctggccgtgtgg
gtggccgaattcaagaagcaccgcgactggttcgccatcgacacctgcgtgcacgccgac
tccaacgatccggccgtgcgtctggacggtatggtgatgccgaaccgtgacgccgccatc
taccgcttcacccagctgaccacgagccagacctatccggccgcgcccgtgcatctgccc
ggacttgaccccgagcgcacctaccgtgtcagcccgcttgacccgagcttggatttgacc
ggtctgaccaacggccagagcactctcggctggtggaacgaggaaggcgtagtcctgacc
ggcgaagccctgcagcgttacggcatccgtcccccgtccctccaccctcagcaggcagta
ctgttcaaagctgtggcggagtga

DBGET integrated database retrieval system