KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_2557Help
Entry
BLIJ_2557         CDS       T02092                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:blon00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2810654..2811604
Genome map
AA seq 316 aa AA seqDB search
MSPVISHPRPAAARHQFDELSPITITVDCPAKTNLTLEVGPAHDEWGGRHELDTIYCAIG
VYDTVTATAKQPGAGFSLELEGAYLGDLASSRSDMRRNHAVLALFAMAQAAEREPDVALT
ITKRIPVGAGLGGGSADAAATMLAVNRLWELNWPIERLRTIAATLGADMPFCLTGGLAYG
TGFGERITDIAPGSRDELALIEQGFSGEVLVGAYQSQLSTPEVYHTFDLVGAAEGDRNHL
QAAAISLHPRSGQAIDAATQAGASHAFVSGSGPSVVAFAADEAAAQRIIDVWRDTAVVDR
IIRAKSPAHPNIGVRQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggtaatttcacatccacgcccagccgctgcccgacatcagttcgatgagctc
tcccccatcaccattacggtggattgcccggctaaaaccaatctcaccttggaagtgggg
cctgctcacgacgagtggggcggacgccacgaactggacaccatctactgtgcaatcggt
gtatacgacaccgtcaccgcaaccgccaagcaacccggagcgggattctctctggagctc
gaaggcgcttatttgggcgacttggcctcctcacgcagcgacatgcgccgcaaccatgcg
gtactggccctcttcgccatggcccaggcggccgaacgcgagccggatgtggcgttgacc
attaccaagcgcattcccgtgggtgccggactaggcggcggttcagccgacgccgcggcg
accatgctggcggtcaatcgtctctgggagctgaactggcctatagagcgcctgcgcacc
attgccgccacgttgggcgcggacatgccgttctgcctgaccggtggccttgcatacggc
accggtttcggcgaacgcatcacggatatcgcccccggcagccgcgatgagctggcgctg
atagaacagggattcagcggcgaagtattggtcggcgcgtaccagtcgcaactcagcact
cctgaggtctaccacacctttgacctcgtgggagccgcagaaggcgaccgcaatcatctg
caggctgcggcaatcagcctgcatccccgcagcgggcaggccatcgacgccgccacgcag
gcgggtgccagccatgcattcgtctccggatccggcccctcagtggtcgctttcgccgcc
gacgaggcagcggcacaacgcattatcgatgtgtggcgcgatacggctgtggtcgatcgc
attattcgagccaaatctcccgcacaccccaatatcggcgtcagacagtga

DBGET integrated database retrieval system