KEGG   Blattabacterium sp. (Panesthia angustipennis spadica): BPAA_067Help
Entry
BPAA_067          CDS       T02525                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
blp  Blattabacterium sp. (Panesthia angustipennis spadica)
Pathway
blp00790  Folate biosynthesis
blp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BPAA_067 (folE)
Enzymes [BR:blp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BPAA_067 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI DUF4844 QueF
Motif
Other DBs
NCBI-ProteinID: BAM99371
UniProt: M4ZS83
Position
82711..83400
Genome map
AA seq 229 aa AA seqDB search
MMEEKHNKIKKKKLNQKYNSILNHSINSDLTSQNNVYFMSDEEKIEKIKKHFFQIMEILG
LDMNDDSLRKTPKRVAKMFIQEIFSGLNPKNTPNFSIFENKYRYNQMLIEKNITVYSTCE
HHFLPIIGKAHVGYISNGKVVGLSKINRIVNFYAKRPQVQERLTIQIVQSLKKMLETQDV
ACIIEAKHLCVNSRGIKDTDSSTVTTELIGSFKNNSEIRKEFLHHIGIS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagaaaaacataataaaattaaaaaaaaaaagttgaatcaaaaatataattct
attttaaatcattcaattaattcagatttgacttcacaaaataacgtttattttatgagt
gatgaagaaaaaattgagaaaataaaaaaacatttttttcagattatggaaattttaggg
ttggatatgaatgatgatagtttacgaaaaacaccaaaacgggttgcaaaaatgtttata
caagaaatattcagtgggcttaacccaaagaatacacctaatttttccatttttgaaaat
aaatacagatataaccaaatgttaatagaaaaaaatataacagtttattccacttgtgaa
catcattttcttcccatcataggaaaagcacatgtaggttatatttctaatggaaaagtt
gtagggctttctaaaatcaatagaattgtcaacttttatgcaaaaagaccacaagttcaa
gaacgtttaacaatacaaattgttcaatccttaaaaaaaatgttagaaacacaagatgta
gcttgtattatagaggcaaaacatttgtgcgtaaattctcgtggaatcaaagatacagat
agtagtactgttactactgagttaataggatcctttaaaaataattcagaaattcgaaaa
gaatttttgcatcatattggaatttcttaa

DBGET integrated database retrieval system