KEGG   Blattabacterium sp. (Panesthia angustipennis spadica): BPAA_354Help
Entry
BPAA_354          CDS       T02525                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
blp  Blattabacterium sp. (Panesthia angustipennis spadica)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BPAA_354 (hemD)
Enzymes [BR:blp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BPAA_354 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
372210..372947
Genome map
AA seq 245 aa AA seqDB search
MKINNILISQPLSGGSNAPYIKLSKNKNINIDFRSFIEVKGASSSDVRKQKINFSDFTVV
LFISKKSVDHYFRLAESMRFKVPVSMRYICQTETIAYYLQKYIVFRKRKIHIGNKSFKDI
LPYIQKHFQEKFLLPSSDILKPEIPDMLNKQNIFWKRAILYKTTSSDLSDLKHIYYDILV
FFSPAEIKSLFDNFPNFDQNNIKIATFGKNTLDAAYKAGLKIDIKVPTPEFPSMAMALEK
YIIKN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaataatattctgatttcacaacctcttagtggtggatctaatgccccatat
ataaaacttagtaaaaataaaaatataaatattgattttaggtcttttatagaagtaaaa
ggagcatcatccagtgatgtaagaaaacagaaaataaacttttctgattttaccgtggtt
ctttttattagtaaaaaatctgtagatcactatttcagactagcagaatcaatgcgtttt
aaagttcctgtttctatgagatatatttgtcaaacagaaactatagcttactatttgcaa
aaatatattgtttttcgaaaaagaaaaattcatattggaaataaatcattcaaagatata
ctcccttatattcaaaaacatttccaagagaaattccttttaccttcttcggatatactg
aaaccagaaattcctgatatgttaaataaacaaaacattttttggaaaagagctatttta
tataaaacaacttctagtgatttatctgatttaaaacatatatactatgatattttagtt
ttttttagtccagcagaaatcaaatctttatttgataattttcctaattttgatcagaac
aatattaaaattgctacctttggtaaaaatacattagatgctgcttataaagcaggatta
aaaattgatataaaagtccccacaccggaatttccttctatggctatggctttagaaaaa
tatattataaaaaactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system