KEGG   Blattabacterium sp. (Panesthia angustipennis spadica): BPAA_354Help
Entry
BPAA_354          CDS       T02525                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
blp  Blattabacterium sp. (Panesthia angustipennis spadica)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:blp00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
372210..372947
Genome map
AA seq 245 aa AA seqDB search
MKINNILISQPLSGGSNAPYIKLSKNKNINIDFRSFIEVKGASSSDVRKQKINFSDFTVV
LFISKKSVDHYFRLAESMRFKVPVSMRYICQTETIAYYLQKYIVFRKRKIHIGNKSFKDI
LPYIQKHFQEKFLLPSSDILKPEIPDMLNKQNIFWKRAILYKTTSSDLSDLKHIYYDILV
FFSPAEIKSLFDNFPNFDQNNIKIATFGKNTLDAAYKAGLKIDIKVPTPEFPSMAMALEK
YIIKN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaataatattctgatttcacaacctcttagtggtggatctaatgccccatat
ataaaacttagtaaaaataaaaatataaatattgattttaggtcttttatagaagtaaaa
ggagcatcatccagtgatgtaagaaaacagaaaataaacttttctgattttaccgtggtt
ctttttattagtaaaaaatctgtagatcactatttcagactagcagaatcaatgcgtttt
aaagttcctgtttctatgagatatatttgtcaaacagaaactatagcttactatttgcaa
aaatatattgtttttcgaaaaagaaaaattcatattggaaataaatcattcaaagatata
ctcccttatattcaaaaacatttccaagagaaattccttttaccttcttcggatatactg
aaaccagaaattcctgatatgttaaataaacaaaacattttttggaaaagagctatttta
tataaaacaacttctagtgatttatctgatttaaaacatatatactatgatattttagtt
ttttttagtccagcagaaatcaaatctttatttgataattttcctaattttgatcagaac
aatattaaaattgctacctttggtaaaaatacattagatgctgcttataaagcaggatta
aaaattgatataaaagtccccacaccggaatttccttctatggctatggctttagaaaaa
tatattataaaaaactaa

DBGET integrated database retrieval system