KEGG   Bifidobacterium animalis subsp. lactis Bi-07: W91_0049Help
Entry
W91_0049          CDS       T02080                                 

Definition
lysosomal glucosyl ceramidase-like protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bls  Bifidobacterium animalis subsp. lactis Bi-07
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bls00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bls00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
53717..55240
Genome map
AA seq 507 aa AA seqDB search
MKALKTTVHYDVTAGRTHTEQTELSVMDEAMNTEHIVESNVVGIYPDYTFQMMEGYGCSL
TESACYLLSKMDSATRKEALAQWFGPAGMDAWFVRVHIDSCDYSLSEYQAVEDPLADPEL
ETFSIDRDRQYILPVLKEAMAMAGHPIHVLLSPWSPPAQWKTPPEMTRNDASVYGGEEGD
VIDLSKPGRCFGGRLKPEYYSSWARYLVRFISAYMAEGVPVTMLSIQNEAAAATSWDSCL
WTGDQEREFLKHHLYPAMEEAGLTDAVKIFIWDHNKERAIEHIDEFMSDPEAAKEVGGFA
YHWYSGDHFEALSMLRGKYPDKVLMHSESCGLHIPGKVTMLDMTDEQIEALPDGDYKTMV
QTTTPNEMDFNDATAYAHDIIGDLNHGMQRWIDWNMIVDRQGGPRHTPGGFAAPIVAEDD
GRYTLTISYRYIREIAQAIKPNAVVLGTSTYSRDIEAVSARNADGSIGVVLLNQAERDIP
VNIRMGGLLVADVPLPARTLSTLVFTE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctcaagaccactgtgcactacgatgtgaccgccgggcgaacccataccgag
cagacggagctctcggtcatggacgaggcgatgaacaccgagcacatcgtcgaatcgaat
gtggtgggaatctacccggactacacgttccagatgatggagggctatggttgctcgctc
accgagtcggcatgctatctgctctccaaaatggactccgcgacgcgcaaagaggccttg
gcccaatggttcggtcccgctggaatggacgcttggttcgtccgcgtacacatcgactcc
tgtgattactcgctcagtgagtaccaggccgttgaggatcctctggccgatcccgaattg
gagaccttctcgattgaccgtgatcgtcagtacattcttccggtgctcaaagaggcgatg
gccatggcggggcatcccattcatgtgttgctctccccatggtcgcctccggcgcaatgg
aagacgcccccggagatgacgcggaacgacgcctcggtgtacggcggcgaggagggcgat
gtcatcgatctgagcaagccggggcgctgtttcggcggaaggctcaagccggaatactat
tcgtcgtgggcgcggtacctcgtcagattcatcagcgcctatatggccgaaggtgttccg
gtgacgatgctgtcgattcagaacgaggcggctgcggccacgagttgggatagctgcctg
tggaccggagatcaggagcgcgaattcctgaagcaccatctctacccggcaatggaggag
gccggtctgaccgatgccgtgaagatcttcatctgggatcataacaaggaacgtgcaatc
gaacacatcgacgagttcatgagcgacccggaggcggcgaaggaggttggcggtttcgct
tatcactggtactccggcgaccatttcgaggcgctgtcgatgttgcgaggcaagtatccc
gacaaggtgctgatgcattccgaaagctgtgggctgcatatacccggcaaggtgaccatg
ctcgatatgaccgatgaacagatcgaggcgctgcccgatggcgactacaagaccatggtg
cagacgaccactccgaacgagatggacttcaatgatgcgacggcctatgcccacgacatc
atcggcgacctgaaccatggaatgcagcggtggatcgactggaacatgatcgtcgacagg
cagggtggtccccgtcataccccagggggtttcgccgcgccgatcgtcgccgaagacgac
ggacggtatacgctgaccatcagctaccggtatattcgcgagattgcacaggccatcaaa
ccgaatgcggtggttctcggcacaagcacgtattcgcgtgatatcgaggcggtctcggcc
cgcaacgcagatggctcaatcggcgtcgtcctccttaatcaggcggagcgcgatatcccg
gtgaacattcgcatgggcggcctgcttgtggcggatgtgccgttgccggcacgcaccttg
agtactctggtgttcacggagtga

DBGET integrated database retrieval system