KEGG   Bifidobacterium animalis subsp. lactis Bi-07: W91_0137Help
Entry
W91_0137          CDS       T02080                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
bls  Bifidobacterium animalis subsp. lactis Bi-07
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bls00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    W91_0137
Enzymes [BR:bls01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     W91_0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
154489..156009
Genome map
AA seq 506 aa AA seqDB search
MKNKVQLITYADRLGDGNLASMTDILRTRFDGVYEGVHILPFFTPFDGADAGFDPIDHTK
VDARLGDWDDIAELAKTHDIMVDAIVNHMSWQSKQFQDVLANGEDSEYYPMFLTMSSVFP
DGATEEELAGIYRPRPGLPFTHYSFAGKTRLVWVTFTPQQVDIDTDSAKGWEYLMSIFDQ
MSKSHVKYIRLDAVGYGAKEAGTSCFMTPKTFELISRLREEGAKRGLEILIEVHSYYKKQ
VEIAAKVDRVYDFALPPLLLHSLFTGKVDALAHWTEIRPNNAVTVLDTHDGIGVIDIGSD
QLDRSLKGLVPDADVDNMVETIAKNTHGESKAATGAAASNLDLYQVNSTYYSALGCNDQH
YIAARAVQFFLPGVPQVYYVGALAGENDMELLKRTNVGRDINRHYYTTSEIDKNLERPVV
KALNALARFRNELPAFDGDFSYSVGDDESIAFSWNGFGSSATLTFTPSKGMGVENPQSVA
TLVWTDSTGEHRTDDLIANPPVMQAS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaaagttcagctgatcacctatgcggatcgcttgggtgacggcaaccttgct
tcgatgaccgacattctgcgcacgcgattcgacggcgtgtacgagggcgtgcacattctg
ccgttcttcaccccgttcgatggcgcggacgcaggcttcgacccgatcgaccacaccaag
gtcgacgcccgcctcggtgactgggatgacatcgccgagctcgccaagacgcatgacatc
atggtcgatgccatcgtcaaccacatgagctggcagtccaagcagttccaggatgtgctc
gcgaacggcgaggattccgagtactacccgatgttcctcacgatgagctccgtgttcccc
gacggcgcgaccgaggaggagctcgccggcatctaccgcccgcgcccgggcctgccgttc
acccactacagcttcgccggcaagacccgcttggtgtgggtcacgttcacgccgcagcag
gtcgacattgacaccgactccgccaagggctgggaatacctgatgtcgatcttcgaccag
atgagcaagtcgcacgtcaagtacattcgcctcgacgccgtcggctacggcgccaaggag
gccggcaccagctgcttcatgacccccaagaccttcgaactcatctcgcgactgcgcgag
gagggtgccaagcgcggtctggagattctcatcgaggtgcactcgtactacaagaagcag
gtggagatcgccgccaaggtggatcgcgtctatgacttcgcgctgccgccattgctgctg
cactcgctgttcaccggcaaggtggacgcgctcgcgcactggaccgagattcgcccgaac
aatgcggtcaccgtgctcgacacgcacgacggcatcggcgtcatcgacatcggctccgac
cagctcgaccgttcgctcaagggtctggtgcccgacgcggacgtcgacaacatggtcgag
acgatcgcgaagaacacccatggcgagtcgaaggccgcaaccggcgccgccgcttcgaac
ctcgacctctaccaggtgaactccacatattattcggcgctcggctgcaatgaccagcat
tacattgccgcacgcgccgtgcagttcttcctgccgggcgttccgcaggtgtactatgtg
ggcgcgctcgccggcgagaacgacatggagctgctcaagcgcacgaatgtgggccgcgac
atcaaccgccactattacacgacctccgagatcgacaagaacctcgaacgtccggtggtc
aaggccctgaacgcgctcgccagattccgcaacgagctgccggcgttcgacggcgacttc
agctactcggtgggcgatgacgagtcgattgcgttctcctggaacggtttcggatcctcc
gctacgctcacgttcacgccgtccaagggcatgggtgtcgagaacccacagtccgtcgcc
acgctcgtctggacggattccactggcgagcaccgcaccgacgacctcattgcgaacccg
cccgtcatgcaggcgagctga

DBGET integrated database retrieval system