KEGG   Bifidobacterium animalis subsp. lactis Bi-07: W91_0394Help
Entry
W91_0394          CDS       T02080                                 

Definition
(GenBank) Alcohol dehydrogenase, Acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bls  Bifidobacterium animalis subsp. lactis Bi-07
Pathway
bls00010  Glycolysis / Gluconeogenesis
bls00071  Fatty acid degradation
bls00350  Tyrosine metabolism
bls00620  Pyruvate metabolism
bls00625  Chloroalkane and chloroalkene degradation
bls00626  Naphthalene degradation
bls00650  Butanoate metabolism
bls01100  Metabolic pathways
bls01110  Biosynthesis of secondary metabolites
bls01120  Microbial metabolism in diverse environments
bls01130  Biosynthesis of antibiotics
bls01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bls00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    W91_0394
   00620 Pyruvate metabolism
    W91_0394
   00650 Butanoate metabolism
    W91_0394
  Lipid metabolism
   00071 Fatty acid degradation
    W91_0394
  Amino acid metabolism
   00350 Tyrosine metabolism
    W91_0394
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    W91_0394
   00626 Naphthalene degradation
    W91_0394
Enzymes [BR:bls01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     W91_0394
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     W91_0394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AFJ17700
Position
463599..466346
Genome map
AA seq 915 aa AA seqDB search
MADKNSAETATKAAKLAVNVEDKKAAAQAEVDALVRKAQKALAEFEKLDQQAVDRIVAKA
SVAALNKHLVLAKLAVDETGRGLVEDKATKNIFACEHVTNYMAGQKTVGIIREDDVLGID
EVAEPVGVVAGVTPVTNPTSTAIFKSLIALKTRCPIVFGFHPGAQKSSVEAARIVRDAAI
EAGAPENCVQWIEHPSIEATGALMQHPGVATILATGGPGMVKAAYSSGKPALGVGAGNAP
AYVDNNVDVQRVANDLILSKHFDYGMICATEQAIIAHKDIYAPLVKELKRRKAYFVNDEE
KAKLEKYMFGCTAFSGETPKLNSVVPGKSPQYIAHEAGFEIPEDATILAAECSEVGENEP
LTMEKLAPVHAVLKFSDKEQGFEMCEEMLKHGAGHTAAIHTNNDDLVREYGLRMHACRII
WNQPSSLGGIGDIYNSIAPSLTLGCGSYGGNSVSGNVQAINLLNIKRIARRNNNMQWFKI
PAKTYFEPNAIKYLRDMYGIERAVIVCDKVMEQLGIVDKVIDQLRARSNRVTFRIVDYVE
PEPSVETVERGAAMMRDEFEPDTIIAVGGGSPMDAAKIMWLLYEHPEIAFSDVREKFFDI
RKRAFKIPPLGTKAKLVCIPTSSGTGSEVTPFAVITDHKTGYKYPITDYALTPSVAIVDP
VLARTQPRRLASDAGFDALTHSMEAYVSVYANDFTDGMALHACKLIWDNLAESVNSEPGE
TKKKAQEKMHNAATMAGMAFGSAFLGMCHAMAHTIGALCHIAHGRTNSILLPYVIRYNGQ
VPEEPTSWPKYSKYIAPERYQELASLLGVDPGKTPAEGVENLAKAVEDYRDNKLGMNKSF
KDCGVDEDYFWSILEQIGMRAYEDQCAPANPRIPQIQDMMDIAIAAYYGVSQAEGHAMRV
EREGVGATEEASERV
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaagaacagcgccgagaccgcaacgaaggcggccaagcttgctgtgaatgtg
gaagacaagaaggccgcggcacaggccgaggtcgacgctctggtcaggaaggcgcagaag
gcgctggcggaattcgaaaagctcgatcagcaggccgtcgatcgcatcgtggcgaaggcc
tccgtggccgccctcaacaagcatctggtgctggcgaaactggcagtcgacgagaccggt
cgtggactcgtcgaagacaaggcgacgaagaacatcttcgcctgcgagcacgtgaccaat
tacatggccggtcagaaaaccgtcggcatcatccgcgaagacgacgtgctcggcatcgac
gaagtggcagaaccggtcggcgtcgtcgcaggcgtcaccccggtgaccaacccgacgtcc
actgccatcttcaagtcgctcatcgccctcaagacccgttgcccgattgtcttcggcttc
cacccgggagcgcagaagagctccgtcgaagcggcgcgcatcgtgcgtgacgccgccatc
gaggcaggtgccccggagaactgcgtgcagtggatcgaacacccgtccatcgaggcgacc
ggcgcgctcatgcagcatcccggcgtggccacgatcctcgcgaccggcggccccggcatg
gtcaaggccgcgtactcgtccggcaagccggccctgggcgtcggcgccggcaatgccccg
gcctacgtcgacaacaacgtcgacgtgcagcgcgtggcgaacgacctcatcctctcgaag
cacttcgactacggcatgatctgcgccaccgagcaggcgatcatcgcgcacaaggacatc
tacgcaccgctcgtcaaggaattgaagcgccgcaaggcatacttcgtcaacgacgaggag
aaggccaagctcgagaagtacatgttcggctgcaccgcgttctccggcgagaccccgaag
ctcaactccgtggtcccgggcaagtctccgcagtacatcgcgcacgaagccggcttcgaa
atccccgaggacgccacgatcctcgctgccgaatgctccgaggtgggcgagaacgagccg
ctcaccatggagaagctggcgccggtgcacgccgtgcttaagttctccgacaaggagcag
ggcttcgaaatgtgcgaggagatgctcaagcacggtgccggccataccgccgcaatccac
acgaacaacgacgacctcgtccgcgagtacggcctgcgcatgcacgcctgccgcatcatc
tggaaccagccgagctcgctcggcggcattggcgacatctacaactccatcgccccgtcg
ctcacgctgggctgcggttcctacggtggcaactccgtctccggcaacgtgcaggcgatc
aatctgctcaacatcaagcgaatcgcgcgaaggaacaacaacatgcagtggttcaagatc
ccggcaaagacgtacttcgagccgaacgccatcaagtacctgcgcgacatgtatggcatc
gagcgtgccgtcatcgtgtgtgacaaggtgatggagcagctcggcatcgtcgacaaggtg
attgaccagctgcgtgcacgctccaaccgagtcaccttccgcatcgtcgactatgtggag
cccgagccgagtgtcgagaccgtcgagcgcggcgccgccatgatgcgcgacgaattcgag
ccggacacgatcatcgccgtcggcggtggctctcccatggacgccgcgaagatcatgtgg
ctgctctatgagcacccggaaatcgcgttctccgacgtgcgtgagaagttcttcgacatt
cgcaagcgcgctttcaagattccgccgctcggcaccaaggccaagcttgtgtgcatcccg
acctcgtcgggcaccggctccgaggtcacgccgttcgctgtgatcaccgaccacaagacc
ggctacaagtacccgatcaccgactacgcgctcacgccgtccgtcgcgatcgtcgacccg
gtgctcgcgcgcacgcagccgcgccgactggcctccgatgccggcttcgatgcgctgacc
cattcgatggaggcctacgtctccgtctatgcgaacgacttcaccgacggtatggcgctg
catgcctgcaagctgatctgggacaaccttgcggagtccgtcaatagcgagccgggcgaa
accaagaagaaggcgcaggagaagatgcacaacgccgccaccatggccggcatggcattc
ggatccgccttcctcggtatgtgccacgccatggcgcacaccatcggcgccctgtgccac
atcgcgcacggccgcacgaactcgattctgctgccatatgtgatccgctacaacgggcag
gtgccggaggagccgacctcctggccgaagtacagcaagtacatcgcgccggagcgttac
caggagctcgcctcgctgctcggggtcgacccaggcaagaccccggccgagggtgtcgag
aatctggcgaaggccgtcgaggactaccgcgacaataagctcggcatgaacaagagcttc
aaggattgcggtgtggatgaggactacttctggagcatcctcgagcagatcggcatgcgc
gcctatgaagaccagtgcgcgcctgcgaatccgcgcatcccgcagatccaggacatgatg
gatatcgccatcgccgcctactacggcgtctcgcaggcggagggccatgcgatgcgcgtt
gagcgcgaaggcgtgggcgccacggaggaagcctccgagcgcgtctga

DBGET integrated database retrieval system