KEGG   Bifidobacterium animalis subsp. lactis Bi-07: W91_0529Help
Entry
W91_0529          CDS       T02080                                 

Definition
Xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bls  Bifidobacterium animalis subsp. lactis Bi-07
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bls00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bls00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
604575..605927
Genome map
AA seq 450 aa AA seqDB search
MAGLWDIDKIEYVGRTKGLQEGLGFQYYDADKVVAGKKMKDWLRFGVAWWHTFDAPLTDP
FGDGTAQRPWDGKYSDPMDNALAKVDYAFEFFTKLGAEYFCFHDRDIAPEGDTLRETNAN
LDRVVDKIEENMQSTGVKLLWNTSSLFTNPRFVAGASTSPFADVYAYAAAQLKHSLEIGK
RLGAENYVFWGGREGYENLWVTDMKREQEHMAKFFHMCADYAKQIGMDAQFLIEPKAKEP
TTHQYDFDAATACNFLRAYDLIDVFKLNLEGNHANLAGHTYQHEIRVARDNGVLGSLDAN
QGDMLLGWDLDEFPTNLYETTSVMWEVLDEGQIGPHGGLNFDAKPRRTSFSAEDLFRAHI
AGMDSFAAGLLVADKMHQDKYIEDLVANRYGSYDSGIGKSIDDGTATLESLNDYAIDMPQ
SEIIASTHPDHLEDVKATINNYIIDALANA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtctgtgggacatcgacaagatcgagtatgtcggtcgcaccaaggggcttcag
gagggactcggcttccagtattatgacgccgacaaagtggtcgccggcaagaagatgaag
gactggctgcgcttcggcgtcgcatggtggcacaccttcgacgcgccgctcaccgacccc
ttcggtgacggcaccgcccagcgcccgtgggatggcaagtattccgacccgatggacaac
gcgctcgccaaggtggactacgcgttcgagttcttcaccaagctcggcgccgagtacttc
tgcttccatgaccgcgacatcgccccggaaggcgatacgctgcgcgagacgaacgccaac
ctcgaccgcgtggtcgacaagatcgaagagaacatgcagtccaccggcgtgaagctgctg
tggaacacctcgtcgctcttcaccaacccgcgcttcgtggcgggcgcctccacctcgccg
ttcgccgacgtctacgcctatgccgcggcgcagctcaagcactccctcgagatcggcaag
cgcctgggcgccgagaactacgtgttctggggcggccgcgaaggctacgagaacctgtgg
gtcaccgacatgaagcgtgagcaggagcacatggcgaagttcttccacatgtgcgccgac
tacgccaagcagatcggcatggacgcccagttcctcatcgagccgaaggccaaggaaccg
acgacgcaccagtacgacttcgacgcggccacggcatgcaacttcctgcgcgcctatgac
ctgatcgacgtcttcaagctcaacctcgaaggcaaccacgcgaacctcgccggccacacc
taccagcacgagatccgtgtcgcgcgtgacaacggcgtgctcggttcgctcgacgccaac
cagggcgacatgctgcttggctgggatctcgacgagttcccgaccaacctgtacgagacc
acctccgtgatgtgggaagtgctcgatgaaggccagatcggccctcacggcggcctcaac
ttcgatgccaagccgcgccgcacctcgttcagcgccgaagacctgttccgcgcgcacatc
gccggcatggactcgttcgccgccggcctgctcgtggcagacaagatgcatcaggacaag
tacatcgaggacctcgtggccaatcgttacggctcctacgattcgggcatcggtaagtcg
atcgacgacggcaccgcgaccctcgaatcgctcaacgactacgccatcgacatgccgcag
tccgagatcatcgcatccacgcaccccgatcacctcgaggacgtgaaggcgaccatcaac
aactacatcatcgacgccctggccaacgcctga

DBGET integrated database retrieval system