KEGG   Bifidobacterium animalis subsp. lactis Bi-07: W91_1019Help
Entry
W91_1019          CDS       T02080                                 

Definition
1,4-alpha-glucan branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bls  Bifidobacterium animalis subsp. lactis Bi-07
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:bls00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    W91_1019
Enzymes [BR:bls01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     W91_1019
Exosome [BR:bls04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   W91_1019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1136807..1139059
Genome map
AA seq 750 aa AA seqDB search
MSNNHFNKDAIVAVDHAQLGTVSEGRFYNPHEILGAHLGSGEYSDTATVRVLRPDAKEVV
IVTPDSETKAEPELNGVYVAVVPAVKTDRGYSVPDYRLRITKEDGSTVVENDPYRYLPTV
GEMDLYLFGEGRHERLWEAMGANVKRYEDSMGGNDGTHGEPVVGTAFTVWAPNAHSVRVV
GDFNGWNGICHSMRELGSSGVWEIFIPGVTAGEKYKYQILNVFNTWEMKADPMERSHEVP
PKTASIVVESEYHWNDSDWMAKRAKTDPHQGPVAIYEVNANSWRDDVHSYRELADKLVPY
VAKLGFTHVEFMPLEEYPYLGSWGYQVTGYYGVDSRLGSPDDFKYLVDKLHEAGIGVIMD
WVPAHFPKDAFALGRFDGTPLYEDPDPTRGEHPDWGTYIFNFGRREVRNFLVADACFWLD
EYHMDGLRVDAVSSMLYLDYSRQPGQWHPNKFGGRENLEAIDFIKEANATAYKNNPGIMM
IAEESTAYPGVTAPTDQGGLGYGLKWNMGWMHDTLEYLHEQPINRKWHHNEITFSMVYAY
SEHYVLPISHDEVVYGKGSLFGKMPGDDWQRYAGVRSLFAYQWAHPGKNLTFMGNELAQY
GEWDYNSQLDWDCLNWPDHRGVQQLVADLNALYKKSPALWSQDFTPDGFQWLTSDDSDHN
TLSFVRIGKNGEQMVVVVNFSGTAWQDYQVALPQGGRWREVLTTDDRKYGGSDIHNTNIE
ANAGPYHSRDYSTKITVPALGVVFLEPDNN
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacaatcatttcaataaagatgccatcgttgcagtggatcatgcccaactcggc
accgtgagcgagggtcgtttctacaaccctcacgagattctcggcgcccacctcggtagc
ggtgaatacagcgacaccgccaccgtccgcgtacttcgccctgacgccaaggaagtcgtc
atcgtcacccccgacagcgagaccaaggccgaaccggaactcaacggcgtctatgtcgcc
gtggttcccgccgtgaaaaccgacagggggtattcggttcccgactaccgcctgcgcatc
accaaggaggacggctccacggtggtggagaacgacccgtatcgatacctgccgaccgtg
ggtgagatggatctctacctgttcggcgaaggacgccatgaacgcctatgggaggccatg
ggcgccaacgtcaagcgatatgaggactccatgggtggcaatgatggcacccatggcgaa
cctgtggtcggcactgcattcaccgtctgggcgccgaatgcacattcggtgcgagtggtg
ggcgatttcaacggatggaacggcatctgccattcgatgcgcgaactcggctcctccggc
gtctgggaaatctttatcccgggtgtgacggccggcgagaaatacaaatatcagattctc
aacgtattcaacacttgggagatgaaggccgacccaatggaacgctcgcacgaggtgcca
ccgaagacggcctcgattgtggtggagtccgaataccattggaacgattccgactggatg
gccaagcgcgcgaaaaccgacccgcaccagggtcccgtggcgatctacgaggtaaatgcg
aacagttggcgtgacgacgtacacagctaccgcgagcttgccgacaagctcgtgccgtac
gtcgcgaagctgggcttcacccacgtggaattcatgccgttggaggaatacccgtacctc
ggcagctggggctatcaggtgaccggctattatggcgtggactcccgcctgggctccccc
gacgacttcaagtatctcgtcgacaagcttcacgaggcgggtatcggtgtaatcatggat
tgggtcccggcgcacttcccgaaggacgccttcgcattgggccgtttcgatggaacgcca
ttgtatgaggacccggatccgacccgcggcgagcatccggattgggggacgtacatcttc
aacttcggccgccgcgaggtgcgcaacttcctggtggccgacgcctgcttctggcttgat
gagtaccatatggacggcctgcgcgtcgacgcggtctcctcgatgctctacctcgactac
agccgtcaacccggtcaatggcatccgaacaagttcggaggacgcgagaacctcgaggcc
atcgacttcatcaaggaggccaacgccacggcctacaagaacaatccgggcatcatgatg
atcgccgaggaatccactgcctacccgggcgtcaccgccccgaccgaccagggcggtctg
ggttatggactcaaatggaacatgggctggatgcacgatacgcttgaatacctgcacgag
cagccgatcaaccgcaagtggcaccacaacgagatcacgttctccatggtctacgcctat
tcggagcattatgtgctgccgatcagccatgacgaggtggtgtacggcaaaggatcgctg
ttcggcaagatgccgggcgacgattggcagcgctacgccggcgtgcgttccctgttcgcc
tatcaatgggcacatccgggcaagaacctcaccttcatgggcaatgaactcgcacagtac
ggtgagtgggactacaacagccagcttgactgggactgcctgaactggcctgatcaccgt
ggcgtgcagcaactggtggccgacctcaacgctctgtacaagaagtctccagccctgtgg
agccaggacttcacccccgacggtttccagtggctcaccagtgacgattcggaccacaat
acgttgagcttcgtgcgaatcggcaaaaacggcgagcagatggtcgtcgtggtcaacttc
tccggaacggcatggcaggactaccaggtggcgctcccacaaggcggccgttggcgggag
gtactcaccactgacgacaggaagtacggcgggtccgacatccacaacaccaatatcgaa
gccaacgccggcccctaccattcgcgcgattattctacgaagataaccgtgccggccctc
ggtgtcgtattcttggaaccggataacaactga

DBGET integrated database retrieval system