KEGG   Bifidobacterium animalis subsp. lactis Bi-07: W91_1596Help
Entry
W91_1596          CDS       T02080                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bls  Bifidobacterium animalis subsp. lactis Bi-07
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bls00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    W91_1596
Enzymes [BR:bls01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     W91_1596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1847943..1850141
Genome map
AA seq 732 aa AA seqDB search
MSQINSAPPRREESPERLARPLIQLAKGCGVATCYIDQLGTYVEIRDAVLISVLGALGVD
ASTPELVDINLNARRNEAHERLVAPTVVKFLGTPASTPLHTKHGEPHIGLTLEDGSDATD
ALSLTFREHDGDVDVYDLAIGDNLEIGYHTLHVRDGETGSERDVDVTLLCAPASIPVPEA
LASHKRWGWMTQMYSVRSPESWGVGDYGDLRELLVDAAGSGADFMLINPVHASAPVSPIE
PSPYSPMSRRFINTTYIRPQDIAEFAELDEQDAAAVRALHEQVAPMNTESSPMDLDAAWK
AKRAALQIIFRQPRSPERQASFEAFKEKAGADLDTWALWSVAFEVLGEPWEPDSWFRMTA
KSNPRIQALRTEHPDLYEFACWLQWIAEEQLDAAQRAARDAGMSLGLMQDMAVGVHSYGA
DAWGNPERFAVGSVTVGCPPDFYNQQGQDWGQPPLNPNYLELTGYRMYREMVHHMFEHAG
AIRIDHILGLFRLWWIPAGQGAKGGAYVTYNYDAMIAVLSIEATRVNGIVIGEDLGTVPD
FVRNVLARHGLLGTTVEWFARVDDSPNAGDPYAMPQTYRTYSLSSVTTHDLPPTAGYLML
EQVKLREELGLLTEPVEEFRESALAERQAMLDLLVQGGWMSQEAADDVPDNLQTIVEAMH
AMLTDAPSLLLQAALVDGVGEARAQNQPGTSTQYPNWRIPLADEHLKVVPTQEVFKSPRV
QALAKIMNRINQ
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagatcaattcagcacccccgcgccgtgaggaaagccccgagcgactcgcacga
ccgctcatccagctcgccaaggggtgcggtgtggccacctgctacatagaccagctcggc
acctatgtggagattcgcgacgcagtgctcatctcggtgctcggcgcgctcggcgtcgac
gcctccaccccggagctcgtcgacatcaatctcaacgcgcgacgcaacgaggcgcacgaa
cgcctggtggcgcccaccgtcgtcaagttcctcggcacccccgccagcacgccgctgcac
accaagcacggggagcctcacatcggactcacgctcgaagacggcagcgacgcgaccgat
gccctctcgctcaccttccgcgagcatgatggcgacgtggacgtctacgacctcgcgatc
ggcgacaatctggagatcggctaccacacactgcatgtgcgcgatggcgaaacgggcagc
gagcgcgacgtcgacgtcacactgttgtgcgcgccggcatccattccggtacccgaggcc
ctcgcctcgcacaagcgctggggatggatgacgcagatgtattcggtgcgctcccccgaa
tcgtggggcgtgggcgactacggggacctgcgcgaactgctggtggacgccgccggctcg
ggtgccgacttcatgctcatcaatccggtgcatgcgagcgcgccggtgagcccgatcgaa
ccgtcgccgtattcgccgatgtcgcgccgcttcatcaacaccacctacattcgcccgcag
gacatcgccgaattcgccgagctcgacgagcaggacgccgccgccgtacgcgcattgcac
gagcaggtcgcgccaatgaacaccgaatcgtcgccgatggatctcgacgccgcctggaag
gcgaaacgcgccgccttgcaaatcatcttcaggcagccgcgctccccggaacgtcaggcg
tcgttcgaggcgttcaaggagaaggccggcgccgacctcgacacctgggcactgtggagc
gtcgcattcgaagtgctcggggagccatgggagccggactcctggttccgcatgaccgcc
aaaagcaatccgcgcatccaggcgctgcgaaccgagcatcccgatctgtatgagttcgcc
tgctggctgcagtggatcgccgaggagcagctcgacgcggcccagcgtgccgcgcgcgac
gctggcatgtcgctcgggctcatgcaggacatggccgtgggcgtgcactcctacggtgcg
gacgcatggggcaacccggaacgcttcgccgtcggctccgtcacggtgggctgcccgccg
gacttctacaatcaacagggtcaggattggggccagcctccgctcaacccgaactatctc
gagctcaccggctaccgcatgtaccgcgagatggtgcaccacatgttcgaacatgcgggc
gccattcgcatcgaccacattctcggactgttccggctgtggtggatcccggccggccag
ggcgccaagggcggcgcatacgtcacctacaactacgatgcgatgatcgcggtgctcagc
atcgaggccacgcgtgtaaacggcatcgtgatcggcgaggatctcggcaccgtgcccgat
ttcgtgcgcaatgtgctcgcacgacacgggctgctcggcaccacggtggagtggttcgcc
cgcgtggacgactcccccaacgccggcgacccgtacgcgatgccgcagacgtaccgcaca
tactcactttcgtcggtcaccacacacgatctgccgccgaccgccggctatctcatgctc
gagcaggtcaaactgcgcgaggagctcggcctgctcaccgagccggtggaggagttccgc
gaatccgcgctcgccgaacggcaggccatgctcgacctgctcgtgcagggcggctggatg
agtcaggaggccgccgacgatgtgccggacaatctgcagaccattgtcgaggcgatgcac
gccatgctcaccgacgcgccttcgctgctgctgcaggccgcgctcgtggacggcgtgggc
gaggcgcgcgcgcagaaccagccggggacgtccacgcagtacccaaactggcgtattccg
ctcgccgacgagcatctcaaggtggtgcccacgcaggaggtgttcaagtcgccgcgcgtg
caggcgctggcgaagatcatgaaccgcattaatcagtag

DBGET integrated database retrieval system