KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_0125Help
Entry
Balat_0125        CDS       T00924                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:blt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Balat_0125
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Balat_0125
  Lipid metabolism
   00071 Fatty acid degradation
    Balat_0125
  Amino acid metabolism
   00350 Tyrosine metabolism
    Balat_0125
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Balat_0125
   00626 Naphthalene degradation
    Balat_0125
Enzymes [BR:blt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Balat_0125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(138893..139951)
Genome map
AA seq 352 aa AA seqDB search
MAENMMKAAVFVEPEHVGVREVERPRIEKPTDAIVRVLKACVCGSDLWWFRGISERPHNT
LVGHEAIGIIDEVGADVHDMKPGDFVIVPFTHCCGHCEACEKGYDGNCFNMEPGGNAGYQ
AEYMRATWAGTALIKIPGTPADYTDEQIASLLALSDVMATGYHAAWSSRIEPGDTVVIYG
DGAVGLCAVIGAKLLGAGRIIMMSRHEDRAALAREFGATDIVPERGDEAVARIMEMTNGA
GADRVLECVGSEQSIESAVRSGRPGAYVSRVGVPHDNSIDVNALFWRNVSLTGGIASVAT
HDKSTLLKAVLDGEINPGKVFTASFDLDHVQQAYEAMDGRRAIKSMIDIAEA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaacatgatgaaagccgcggtgttcgtggaacccgaacacgtcggagtgcgc
gaagtggagcgcccgagaatcgagaagcccaccgacgcgattgtgcgcgtgctcaaggca
tgcgtatgcggctcggatctgtggtggttccgcggcatctcggagcgcccgcacaacacg
ctcgtgggccacgaggcgatcggcatcatcgacgaggtgggcgccgacgtgcacgacatg
aagcccggcgacttcgtgatcgttcccttcacccactgctgcgggcactgcgaggcctgc
gagaagggatacgacggcaactgcttcaacatggagcccggcggcaatgccggctaccag
gccgaatacatgcgcgccacctgggcaggcaccgcgctcatcaagattccgggtacgccc
gccgactacaccgacgagcagatcgcctcgctgctggcgctctcggacgtcatggcgacc
ggctatcacgccgcgtggagctcgaggatcgaacccggcgacaccgtggtgatctacggg
gacggcgccgtgggcctgtgcgcggtgatcggtgcgaagctgcttggcgctggcaggatc
atcatgatgagccgtcatgaggatcgtgcggcacttgcccgtgaattcggcgcgaccgac
atcgttcccgagcgcggcgacgaggcggtggcccgcatcatggagatgacgaacggcgcg
ggcgccgaccgcgtgctcgaatgcgtcggttccgagcagagcattgaatccgccgtgcgc
agcggacgcccgggtgcctatgtgagccgcgtcggcgtgccacatgacaacagcatcgac
gtgaacgcgctgttctggcgcaatgtatcgctgaccggcggcatcgcctcggtggccacg
cacgacaagagcacactgctcaaggccgtgctcgacggcgaaatcaacccgggcaaggtg
ttcaccgcctccttcgacctcgaccatgtgcagcaggcctatgaggcgatggacggacgc
cgtgccatcaagtcgatgatcgacatcgccgaagcgtaa

DBGET integrated database retrieval system