KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_0212Help
Entry
Balat_0212        CDS       T00924                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:blt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Balat_0212 (recR)
DNA repair and recombination proteins [BR:blt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Balat_0212 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
247789..248391
Genome map
AA seq 200 aa AA seqDB search
MALAYDGAIQRLIDSFASLPGIGPKGAQRIAFYLLQAPDAESQRLVDAINEVKEKVRFCE
VCGNVCESSPCTICSDPRRDHGTICVVEEPKDVMSIERTREYRGLYQVLGGAINPMANVG
PSDLNIAQLLNRLHDGEVKEIIVALNPNIEGEATTTYLSRLLAPLDIKVTRLASGLPVGG
DLEYADEITLSRALEGRREV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcattggcatacgacggcgccatccagcggctcatcgactcgtttgcgagtctgccg
ggcatagggcccaaaggagcgcaacgcatcgccttctatctgctgcaggcgccggatgcg
gagtcgcagcgcctcgtcgacgcaatcaacgaggtgaaggagaaagtacggttctgcgaa
gtctgcgggaatgtgtgcgaaagcagcccgtgcacaatctgctcggatccgcgtcgtgat
cacggcacgatctgcgtggtggaggagccgaaggacgtcatgagcatcgaacgcacgcgc
gaataccgcgggctctaccaggtgctgggcggcgccatcaacccgatggccaacgtcggc
ccgagcgacctcaacatcgcgcagctgctcaacagactccacgacggcgaggtcaaggag
atcatcgtggcgctcaatccgaacatcgagggggaggcaaccaccacctacctgagccgc
ctgctcgcgccgctcgacatcaaggtgacgcgtctggcgagcggtctgccggtgggcggc
gacctcgagtacgccgacgaaatcacgttgtctcgcgcgctcgaagggcgtcgtgaggtg
tga

DBGET integrated database retrieval system