KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_0446Help
Entry
Balat_0446        CDS       T00924                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Pathway
blt00010  Glycolysis / Gluconeogenesis
blt00260  Glycine, serine and threonine metabolism
blt00680  Methane metabolism
blt01100  Metabolic pathways
blt01110  Biosynthesis of secondary metabolites
blt01120  Microbial metabolism in diverse environments
blt01130  Biosynthesis of antibiotics
blt01200  Carbon metabolism
blt01230  Biosynthesis of amino acids
Module
blt_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Balat_0446
  Energy metabolism
   00680 Methane metabolism
    Balat_0446
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Balat_0446
Enzymes [BR:blt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Balat_0446
Membrane trafficking [BR:blt04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Balat_0446
Exosome [BR:blt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Balat_0446
  Exosomal proteins of melanoma cells
   Balat_0446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACS47393
Position
529889..530629
Genome map
AA seq 246 aa AA seqDB search
MTYKLVLLRHGQSEWNKTNQFTGWVDVPLTEKGREEAKNGGKLMKDKGVLPDIVFTSLLR
RAINTANIALDEADRLWIPVKRDWRLNERHYGALQGKNKTEIREEYGDEKFMLWRRSYGT
PPPEIDPNDQYAQNNDPRYAGDPVPEAECLADVVARVEPYWEAEIIPELKSGKTVLIAAH
GNSLRAIVKMLDGLTEEEIAKVNIPTAIPLVYELDENFKPIKKGGEYLDPEAAAAGAAAV
AAQGQK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacttacaaactggtactgctccgacatggtcagagcgaatggaacaagacaaatcag
ttcaccggctgggttgacgtcccgctgaccgaaaagggccgcgaggaagccaagaacggc
ggcaagctcatgaaggacaagggtgtgctgcccgacatcgtcttcacctcgctgctgcgc
cgcgccatcaacaccgcgaacatcgcgctcgatgaggccgaccgcctgtggattcccgtg
aagcgcgactggcgcctcaacgagcgtcactacggtgctctgcagggcaagaacaagacc
gagatccgcgaggagtacggcgacgagaagttcatgctgtggcgccgctcctacggcacc
ccgccgcccgagattgacccgaacgaccagtacgcgcagaacaacgacccgcgttacgcc
ggcgacccggttccggaagccgagtgcctcgccgacgtcgtcgcccgcgtcgagccgtat
tgggaagccgagatcatcccggagctcaagagcggcaagaccgtgctcatcgccgcccac
ggcaattcgctgcgtgcgatcgtcaagatgctcgacggcctgaccgaagaggagatcgcc
aaggtgaacatcccgaccgcgattccgctggtctatgagctcgacgagaacttcaagccg
atcaagaagggtggcgaatacctcgatcctgaggccgctgccgccggtgccgccgctgtt
gcggcccagggccagaagtga

DBGET integrated database retrieval system