KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_0446Help
Entry
Balat_0446        CDS       T00924                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:blt01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:blt01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:blt00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:blt00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:blt00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
529889..530629
Genome map
AA seq 246 aa AA seqDB search
MTYKLVLLRHGQSEWNKTNQFTGWVDVPLTEKGREEAKNGGKLMKDKGVLPDIVFTSLLR
RAINTANIALDEADRLWIPVKRDWRLNERHYGALQGKNKTEIREEYGDEKFMLWRRSYGT
PPPEIDPNDQYAQNNDPRYAGDPVPEAECLADVVARVEPYWEAEIIPELKSGKTVLIAAH
GNSLRAIVKMLDGLTEEEIAKVNIPTAIPLVYELDENFKPIKKGGEYLDPEAAAAGAAAV
AAQGQK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacttacaaactggtactgctccgacatggtcagagcgaatggaacaagacaaatcag
ttcaccggctgggttgacgtcccgctgaccgaaaagggccgcgaggaagccaagaacggc
ggcaagctcatgaaggacaagggtgtgctgcccgacatcgtcttcacctcgctgctgcgc
cgcgccatcaacaccgcgaacatcgcgctcgatgaggccgaccgcctgtggattcccgtg
aagcgcgactggcgcctcaacgagcgtcactacggtgctctgcagggcaagaacaagacc
gagatccgcgaggagtacggcgacgagaagttcatgctgtggcgccgctcctacggcacc
ccgccgcccgagattgacccgaacgaccagtacgcgcagaacaacgacccgcgttacgcc
ggcgacccggttccggaagccgagtgcctcgccgacgtcgtcgcccgcgtcgagccgtat
tgggaagccgagatcatcccggagctcaagagcggcaagaccgtgctcatcgccgcccac
ggcaattcgctgcgtgcgatcgtcaagatgctcgacggcctgaccgaagaggagatcgcc
aaggtgaacatcccgaccgcgattccgctggtctatgagctcgacgagaacttcaagccg
atcaagaagggtggcgaatacctcgatcctgaggccgctgccgccggtgccgccgctgtt
gcggcccagggccagaagtga

DBGET integrated database retrieval system