KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_0690Help
Entry
Balat_0690        CDS       T00924                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Pathway
blt00010  Glycolysis / Gluconeogenesis
blt00520  Amino sugar and nucleotide sugar metabolism
blt01100  Metabolic pathways
blt01110  Biosynthesis of secondary metabolites
blt01120  Microbial metabolism in diverse environments
blt01130  Biosynthesis of antibiotics
blt01200  Carbon metabolism
Module
blt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:blt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Balat_0690
   00520 Amino sugar and nucleotide sugar metabolism
    Balat_0690
Enzymes [BR:blt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Balat_0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Pneumo_M2
Motif
Other DBs
NCBI-ProteinID: ACS47630
Position
813634..814404
Genome map
AA seq 256 aa AA seqDB search
MIDTAQAFGVDIGGSGIKAAPVNLEKGEFAEPRLKILTPEHSTPKAVGDIVRQQLEHFEV
PEDVPVGIAFPAPIKPGKKLDFMANLDQSWIGVDVTEVFSEACGRPVTVVNDADAAGLAE
QAFGAAAGQDGLVIATTLGTGIGTALIYDGVLIPNTELGHIQLPKGKGDAEKYAASSVRE
KLDMGYRKWAKRLTKYYGLMELYFSPELFVVGGGVSRVSEKFLPYIDIKTPIVAAKLHNE
AGIVGAAYYANQQSAK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgattgacactgcacaagcattcggcgttgacatcggtggctcgggcatcaaggccgct
ccggtgaatctggagaagggcgaattcgccgaaccccgcctgaagatcctcactccagag
cattccactcccaaggctgtgggagacattgtgcgccagcagctcgagcatttcgaagtg
cccgaggacgtaccggtgggaattgcgttcccggccccgatcaagccgggtaagaagctc
gacttcatggcgaacctcgatcagtcgtggattggtgtggacgtgaccgaggtgttctcc
gaggcatgcggccgtcctgtcaccgtggtcaacgacgcggacgcggccggtctggcggaa
caggcgttcggtgcggcggcgggccaggatgggcttgtcatcgccaccaccctcggcacc
ggcatcggtaccgccctgatctacgatggcgtgctcatccccaacaccgagctcggccac
atccaactgccgaagggcaagggcgatgcggagaagtatgcggcatcctcggtccgtgag
aaactcgacatgggctacaggaagtgggccaagcgcctcaccaagtactacggtctcatg
gagctgtacttcagccccgagttgttcgtggtcggcggtggtgtgagccgcgtctccgag
aagttcctgccgtacatcgacatcaagaccccgattgtcgccgccaagctgcataacgag
gcgggcatcgtgggtgccgcctactacgccaaccagcagtcggccaagtag

DBGET integrated database retrieval system