KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_0690Help
Entry
Balat_0690        CDS       T00924                                 

Definition
polyphosphate glucokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:blt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Balat_0690
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Balat_0690
   00520 Amino sugar and nucleotide sugar metabolism
    Balat_0690
Enzymes [BR:blt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Balat_0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
813634..814404
Genome map
AA seq 256 aa AA seqDB search
MIDTAQAFGVDIGGSGIKAAPVNLEKGEFAEPRLKILTPEHSTPKAVGDIVRQQLEHFEV
PEDVPVGIAFPAPIKPGKKLDFMANLDQSWIGVDVTEVFSEACGRPVTVVNDADAAGLAE
QAFGAAAGQDGLVIATTLGTGIGTALIYDGVLIPNTELGHIQLPKGKGDAEKYAASSVRE
KLDMGYRKWAKRLTKYYGLMELYFSPELFVVGGGVSRVSEKFLPYIDIKTPIVAAKLHNE
AGIVGAAYYANQQSAK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgattgacactgcacaagcattcggcgttgacatcggtggctcgggcatcaaggccgct
ccggtgaatctggagaagggcgaattcgccgaaccccgcctgaagatcctcactccagag
cattccactcccaaggctgtgggagacattgtgcgccagcagctcgagcatttcgaagtg
cccgaggacgtaccggtgggaattgcgttcccggccccgatcaagccgggtaagaagctc
gacttcatggcgaacctcgatcagtcgtggattggtgtggacgtgaccgaggtgttctcc
gaggcatgcggccgtcctgtcaccgtggtcaacgacgcggacgcggccggtctggcggaa
caggcgttcggtgcggcggcgggccaggatgggcttgtcatcgccaccaccctcggcacc
ggcatcggtaccgccctgatctacgatggcgtgctcatccccaacaccgagctcggccac
atccaactgccgaagggcaagggcgatgcggagaagtatgcggcatcctcggtccgtgag
aaactcgacatgggctacaggaagtgggccaagcgcctcaccaagtactacggtctcatg
gagctgtacttcagccccgagttgttcgtggtcggcggtggtgtgagccgcgtctccgag
aagttcctgccgtacatcgacatcaagaccccgattgtcgccgccaagctgcataacgag
gcgggcatcgtgggtgccgcctactacgccaaccagcagtcggccaagtag

DBGET integrated database retrieval system