KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_0738Help
Entry
Balat_0738        CDS       T00924                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Pathway
blt00260  Glycine, serine and threonine metabolism
blt00750  Vitamin B6 metabolism
blt01100  Metabolic pathways
blt01110  Biosynthesis of secondary metabolites
blt01120  Microbial metabolism in diverse environments
blt01230  Biosynthesis of amino acids
Module
blt_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:blt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Balat_0738
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Balat_0738
Enzymes [BR:blt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Balat_0738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP CSN8_PSD8_EIF3K
Motif
Other DBs
NCBI-ProteinID: ACS47678
Position
complement(872153..873640)
Genome map
AA seq 495 aa AA seqDB search
MSTFHSTRSSDEAFTSKQAIRKGIADDGGLFVTDALGETKIDISDLAGKSYQQIALTVLS
VLLDDYTEEELSQCIAEAYGSQWSDERITPVKPLGNDFIMELFNGPTCAFKDVALQILPR
LMARTTPADGDCDEKIMIVTATSGDTGKAALAGFADAQGTGITVFYPQGKVSRVQELQMT
TQQGSNVNVCAVDGNFDDAQSTVKRIFGDRDLASRLEADAHVRLSSANSINVGRLVPQVV
YYFSAYAQLLEQQVINVGDQVDFVVPTGNFGNVLAGYYAKLLGLPVRQLVVASDRNNVLF
DFLTTGTYNSKRPFFETTSPSMDILVSSNLERMLYYMSERDPRMITYLMNDLAEWGTYEV
PPEMLMEIRKVFATGWADEDQVREMIADCWDRNHYVIDPHTACGYFVMQQMPADPQVPRV
LLSTASPYKFPRVVNEALGLKADGTDFECMDELHAKSGTPIPQMLRNLENAEVRFRDCVE
VSDMGHYVEECADRL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagcactttccacagcacacgcagcagcgacgaggcattcacatccaagcaggcgata
cgcaagggcatcgccgacgatggcggcctgttcgtcaccgacgcccttggggagacgaag
attgacatcagcgatcttgcgggtaaaagctaccagcagattgctttgacggtgttgtcg
gtgctgcttgacgactacaccgaggaggagctttcccagtgcatcgccgaggcatacggc
tcccaatggagcgatgagcgcatcactccggtcaaaccgctgggcaacgacttcatcatg
gaattgttcaacgggccgacctgtgcgttcaaggacgtcgcgttgcagatccttccccgg
ctgatggcccgcaccactccggcggacggggattgcgatgagaagatcatgattgtcacc
gctacctctggggataccggcaaggcggcgcttgccggattcgcggatgcgcagggcacc
ggcatcacggtgttctatccgcagggcaaggtctcccgcgttcaggaactgcagatgacc
acgcaacaggggtccaatgtgaacgtatgcgcggtggatggcaatttcgatgatgcccag
tccacggtcaaacgcatcttcggcgaccgtgatctcgcgtcacgccttgaggcggacgcg
catgttcgcctttcctctgcgaattcgatcaatgtggggcgtctcgtaccgcaggtcgtc
tattatttctccgcttacgcacagctgcttgaacagcaggtgatcaatgtgggcgaccag
gtggacttcgtggtgcccaccggtaatttcggcaatgtgcttgccggatattacgccaaa
ctgctgggcctgccggtacgtcaactcgtcgtcgcctccgaccgcaacaatgtgctcttc
gacttcctcaccaccggcacctacaacagcaagcggccgttcttcgagaccacgtcgccg
tccatggacattctcgtctcctcgaatctggagcgcatgctctactacatgagcgagagg
gatccgcgtatgatcacctatctcatgaacgatctcgccgaatggggaacctacgaggtg
cctccggagatgctcatggagattcgcaaggtgttcgccaccggttgggccgatgaggat
caggtgcgcgagatgatcgccgactgctgggatcgcaaccactatgtgatcgacccgcat
accgcatgcggttatttcgtgatgcagcagatgccagcggatccgcaggtgcctcgtgtg
ctgctgtccactgccagcccgtacaagttcccgcgcgtggtcaatgaggcgcttgggctg
aaggcggatggcaccgatttcgaatgcatggacgaattgcacgccaaatcaggcacgccg
attccgcagatgctgcggaatctggagaatgccgaggtgcggttccgcgactgcgtcgag
gtgagcgacatgggccactacgtcgaggaatgcgccgaccggctatag

DBGET integrated database retrieval system