KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_0746Help
Entry
Balat_0746        CDS       T00924                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Balat_0746
   01230 Biosynthesis of amino acids
    Balat_0746
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Balat_0746
  Energy metabolism
   00680 Methane metabolism
    Balat_0746
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Balat_0746
Enzymes [BR:blt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Balat_0746
Exosome [BR:blt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Balat_0746
  Exosomal proteins of melanoma cells
   Balat_0746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
879622..880254
Genome map
AA seq 210 aa AA seqDB search
MQGSIDIPLDEVGLWQVNQSAQSLIKLYVLPDPSRHQLVVSSDLERSMQTAHAFADRLGS
EVHADERLRERHFGEFEGRSGAYLQANFPQDFDSWCRGMGGEMNHGAESHEHAGVRSMEA
MNDWAHECDDDTDLFVFSHGALIENALQVLFGIERRYPDFTLTSMCNAHWARLRRADIDM
DSRWIMEDYNHGPALADTQYWERPDTLPAK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgcagggatcgatcgacattccgctcgatgaggtcgggctgtggcaggtgaaccagtcc
gcgcagtcactgattaagctatatgtgctcccagacccatctcggcaccagctcgttgtg
tcctccgacctcgaacgttcgatgcagacggcacatgccttcgccgatagactggggtcc
gaagtgcatgccgacgaacggttgcgcgagcggcatttcggtgaattcgaaggccgatcc
ggcgcatacctgcaggccaatttcccgcaggacttcgactcgtggtgccggggcatgggc
ggcgagatgaatcatggcgccgaatcccacgaacatgccggtgtccgcagcatggaggcc
atgaatgattgggcccatgaatgcgatgacgacaccgacttgttcgtattctcccatggc
gcgctcatcgaaaacgcgctgcaggtgctgttcggcatcgaacgacgatacccggatttc
acgctcacctcgatgtgcaacgcgcactgggccagactgagaagggccgatatcgacatg
gacagccggtggatcatggaggactacaaccatggacccgccctggccgatacacagtat
tgggagcgcccagacactttgccagcgaaatga

DBGET integrated database retrieval system