KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_0789Help
Entry
Balat_0789        CDS       T00924                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Balat_0789 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Balat_0789 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Balat_0789 (trpA)
Enzymes [BR:blt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Balat_0789 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
919501..920370
Genome map
AA seq 289 aa AA seqDB search
MTEYNTTPSGQPLGISHRPSPCRELFTRFKAQDKPAFIGYLPFGFPTMEQSLEAFATMVE
NGADIVEIGLPYSDPVMDGPVIQAASQIALNNGERIADVFKAVETVANAGGVPLIMSYWN
LIYHYGVERFAADFANAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSTDERLR
VVCENARGFVYAASRMGVTGERSSLGTSPEDLVARTRKAGAENVCVGIGVSTAAQGKAVG
QYADGVIVGSALVHTLLTEDGDARELTSGLAALAAKTAELAEGIHNARL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatacaacaccacgccaagcggtcagccgcttggaatcagccatcgtcccagc
ccatgccgcgagctgttcacacggttcaaagcgcaggacaagcctgcattcattgggtac
ctgccattcggattccccacgatggaacagtcactcgaggccttcgccacgatggtcgag
aacggtgctgacattgtcgagataggactgccgtattccgatccggtgatggatggcccg
gtgatccaggccgccagccagatcgccctgaacaatggcgagcgcatagccgatgtgttc
aaggccgtggagacggtggccaatgccggtggagtgccgctcatcatgagctactggaac
ctcatctaccattatggggttgaacgcttcgccgctgatttcgcgaatgcaggaggcgca
ggccttatcactcccgatctcattcccgacgaggcaggggagtggatcgaggcgtcggac
cgccatgggctcgatcgcatcttccttgtttcccccgactccaccgatgagcgtctgcgg
gtggtgtgtgaaaacgcccggggattcgtctatgcggcatcgcgcatgggcgtgactggc
gaacggtcgagtctagggacttccccggaggatcttgtggcccggacccgtaaggccggg
gccgagaatgtgtgtgtgggcatcggcgtctccaccgctgctcaaggcaaggccgtcggg
cagtatgcagacggggtcatcgttggatccgccttggtccacaccctgctcaccgaggat
ggcgatgcgcgcgagctcacctcaggtctggctgcgttggcggccaagaccgcagaactc
gccgagggcatccacaacgcacgcctgtag

DBGET integrated database retrieval system