KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_0808Help
Entry
Balat_0808        CDS       T00924                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:blt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Balat_0808
   00052 Galactose metabolism
    Balat_0808
   00500 Starch and sucrose metabolism
    Balat_0808
   00520 Amino sugar and nucleotide sugar metabolism
    Balat_0808
Enzymes [BR:blt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Balat_0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(935563..936990)
Genome map
AA seq 475 aa AA seqDB search
MTDAFERTAEKMKAHGLSETAIAQFEHLYDVWQHEDGTTWIREEDIEPVQDIPNFAQIYE
TINHDKAVDAFAKTAFLKLNGGLGTSMGLDCAKSLLPVRRHKAKQMRFIDIILGQVETAR
NRLGVELPLTFMNSFRTSADTMKVLNRDKRFHQDDIPMEIIQHVEPKIDLSTGEPVSFPS
NPDLEWCPPGHGDLYSTLWESGLLDILESHGFKYLFISNSDNLGARPSRTLAQHFENTDA
PFMIEVSKRTEADRKGGHIVRDKVTGRLMLREMTQVAPEDAAEAKNIDKHPYFNTNNIWV
RIDSLREKLAQSNGVLPLPVIRNYKTVDPTDASTTEVIQLETAMGAAVSLFNGAICVEVD
RMRFLPVKTTDDLFIMRSDRFHLTDQYEMEDGNYIFPNVQLDTRFYKNIHDFDDRFPYGV
PSLAAAASVTVEGDWTFGRDVNFYGEATLHDEGRPSYVPNGEFVGPQGIEPDEWL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcattcgagcgaaccgccgagaagatgaaggcccacggcctgagcgagacg
gccatagcccaattcgagcatctctatgatgtgtggcagcacgaggacggcaccacttgg
attcgcgaggaggacatcgagccggtccaggacattcccaatttcgcgcagatctatgag
acgatcaaccacgacaaggcggtcgacgcattcgccaagacggcgttcctcaagctcaac
ggcggtctgggaacctcgatggggctcgactgcgcaaaatcattgttgccggttcgcagg
cacaaagccaagcaaatgcgcttcatcgacatcattctcggacaggtggaaaccgcacgc
aaccgactgggcgtggagctcccgctgacgttcatgaactcgttccgcacatcggccgac
accatgaaggtgctcaaccgagacaagcggttccatcaggatgatattccgatggagatc
atccagcacgtggagcccaagatcgatctttcgacgggggagccggtgtcattcccctcc
aatcccgatctcgaatggtgcccacccgggcacggcgacctgtattcgaccctctgggaa
tcgggtctgctcgacattctcgaaagccacggattcaagtacctgttcatctcgaactca
gacaatctgggggcacgtccgtcacgcactctggcccagcacttcgaaaacaccgacgct
ccgttcatgatcgaagtgtcgaaacgcaccgaagcggatcgcaagggtggtcacatcgtt
cgcgacaaggtcaccggtagactcatgttgcgcgagatgacgcaggtggcccctgaagac
gcggcggaagccaagaacatcgacaagcatccgtatttcaatacgaacaacatctgggtg
cgcatcgactccctacgcgagaagctggcacagagcaacggcgtgctcccgttgcctgtc
attcgcaattacaagaccgtcgacccaacggatgcctccaccaccgaggtgattcagctc
gagaccgcgatgggcgctgcagtgagtctgttcaatggggcgatctgcgtcgaggtggac
cgcatgcgcttcctgccggtgaaaaccaccgacgacctgttcatcatgcgctccgaccgc
ttccatctgaccgatcagtacgagatggaggacggcaactacatcttcccgaacgtccag
cttgacacgcgcttctacaagaacatccatgatttcgacgaccgcttcccctacggcgtg
ccatcgcttgcagcggctgcctcggtcacggtggagggggattggaccttcggccgtgat
gtgaacttctatggtgaggcgacattgcatgatgagggtaggccgagttatgtcccaaac
ggcgaattcgtaggaccgcagggtatagagcccgacgaatggctgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system