KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_0850Help
Entry
Balat_0850        CDS       T00924                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Pathway
blt00010  Glycolysis / Gluconeogenesis
blt00051  Fructose and mannose metabolism
blt00562  Inositol phosphate metabolism
blt01100  Metabolic pathways
blt01110  Biosynthesis of secondary metabolites
blt01120  Microbial metabolism in diverse environments
blt01130  Biosynthesis of antibiotics
blt01200  Carbon metabolism
blt01230  Biosynthesis of amino acids
Module
blt_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Balat_0850
   00051 Fructose and mannose metabolism
    Balat_0850
   00562 Inositol phosphate metabolism
    Balat_0850
Enzymes [BR:blt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Balat_0850
Exosome [BR:blt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Balat_0850
  Exosomal proteins of bladder cancer cells
   Balat_0850
  Exosomal proteins of melanoma cells
   Balat_0850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACS47779
Position
complement(974225..975037)
Genome map
AA seq 270 aa AA seqDB search
MASTRRIPMVAGNWKMNFDHLEATEFVRAFSKNLKRCHFDFNRCEVALFPSFTSIRSVQV
MVESEHLRIRYGAQAVSVTSQGAFTGDVSADMLAHLGCSYVIVGHSERRKYHPEDDANIV
DQVRAVLAAGMQPILCVGESLEERRKGIELEFAVGQVHDVTRDLSDGEASKLIIAYEPVW
AIGTGMVATPQTAQDAAHAFRVDLAKSFGDHVAQTVRVLYGGSVSSKNCVELIEEPDVDG
FLIGGAALDVDELTTICRKTIATTSSHDNS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgacacgacgcatccccatggttgcgggcaattggaagatgaacttcgatcat
cttgaggcgaccgagttcgtccgggcattctccaagaacctcaaacgatgccattttgac
ttcaatcgttgcgaagtggcgctcttcccgtcattcacctcgattcgtagcgttcaggtg
atggtggaatccgaacacttgcgcatcagatacggggcccaggccgtttcggtcacgtca
cagggggcgttcaccggtgacgtctctgcggacatgctcgcgcatctgggttgcagctat
gtgattgtaggccattcggaacggcgcaaataccatccggaggacgatgcgaacatcgtc
gatcaggtacgagcggtgcttgccgccggcatgcagccaatcctatgcgtcggcgagagt
ctggaggagaggcgaaagggcattgaacttgagtttgccgtcggacaggtgcatgacgtg
acacgcgacctttccgatggggaggcatcaaaactcatcatcgcctatgaacccgtctgg
gcgattggcacgggcatggttgctacaccgcagacagcgcaggacgccgcccatgccttc
cgcgtggatctggcgaaatcattcggcgaccatgtggcgcagaccgtgcgtgtactgtat
ggaggctcggtgtcttcgaagaactgtgtggagctgattgaggagccggacgtcgacggc
ttcctcatcggaggtgccgccctcgacgtcgatgagctcaccacaatctgcaggaagacg
attgcgacaacatcttcacatgataatagttga

DBGET integrated database retrieval system