KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_0880Help
Entry
Balat_0880        CDS       T00924                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Pathway
blt00240  Pyrimidine metabolism
blt00250  Alanine, aspartate and glutamate metabolism
blt01100  Metabolic pathways
Module
blt_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:blt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Balat_0880 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Balat_0880 (pyrB)
Enzymes [BR:blt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Balat_0880 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACS47809
Position
complement(1008619..1009578)
Genome map
AA seq 319 aa AA seqDB search
MGTSVITLDDLTVTQIEELLHKAQYIDSHRKEVAHTCDGRVLATLFYEPSTRTRLSFETA
MLRLGGKVIGFAGSQLSSATKGESISDTLKTVSNYVDVVAIRHPKEGAALVAADASSVPV
INAGDGGHMHPTQTLADLATLQSRFGRVNGLTIGLCGDLTFGRTVHSLIETLCRFGNVRF
VLISPKELRTPQYVLNRINATPTCSYEEVTDLSTVIGDLDALYMTRVQKERFFNEDDYLR
LRDTYILDEGKLAKAKPTMAVLHPLPRVNEIATEVDVDPRAAYFEQVKNGMLMRMALESS
VLGDELPGYEQYANQEVEA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaccagcgtcatcaccctcgacgatctcacagtcacgcaaatcgaggagttgctg
cataaagcgcagtacatcgattcgcatcgcaaggaagtggcacacacctgtgacggacgg
gtgttggccactttgttttatgagccaagcacgcgcacgcgactgagcttcgagaccgca
atgctgcggttgggcggcaaggtgatcggttttgcgggatcgcagctgagctccgcaacg
aagggcgaatcgatttcggacacgttgaagaccgtgtcgaactacgtcgacgtcgtggcg
atccgtcacccgaaggaaggcgccgccctggtggccgcggacgcctcctcggtgccggtg
atcaacgccggcgacggcggccacatgcacccgacgcagacgctcgccgatctcgcgaca
ctgcagtcgcgattcggacgggtgaacggcctgacgatcggcctgtgcggcgacctgacc
ttcggccgcaccgtgcactcgctcatcgagacgctgtgccgcttcggcaacgtgcgtttc
gtgctcatctcaccgaaggagctgcgcaccccgcaatacgtgctcaaccgcatcaacgcc
acgcccacctgctcgtacgaggaggtcaccgacttgagtacggtcataggggatctggac
gccctgtacatgacgcgcgtgcagaaggaacgcttcttcaacgaagacgattacctgcgc
ctgcgtgacacctacattcttgacgagggcaaactcgcgaaggccaaacccacgatggcg
gtgctgcacccgttgccgcgcgtcaacgaaatcgccacggaggtggacgtcgacccccgt
gccgcctatttcgaacaggtgaagaacggcatgctcatgcgcatggcattggaaagctcg
gtgctcggcgacgaattgcccggctacgagcagtatgcgaaccaggaggtcgaagcctga

DBGET integrated database retrieval system