KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_0995Help
Entry
Balat_0995        CDS       T00924                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:blt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Balat_0995
Enzymes [BR:blt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Balat_0995
Exosome [BR:blt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Balat_0995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1136726..1138939
Genome map
AA seq 737 aa AA seqDB search
MDHAQLGTVSEGRFYNPHEILGAHLGSGEYSDTATVRVLRPDAKEVVIVTPDSETKAEPE
LNGVYVAVVPAVKTDRGYSVPDYRLRITKEDGSTVVENDPYRYLPTVGEMDLYLFGEGRH
ERLWEAMGANVKRYEDSMGGNDGTHGEPVVGTAFTVWAPNAHSVRVVGDFNGWNGICHSM
RELGSSGVWEIFIPGVTAGEKYKYQILNVFNTWEMKADPMERSHEVPPKTASIVVESEYH
WNDSDWMAKRAKTDPHQGPVAIYEVNANSWRDDVHSYRELADKLVPYVAKLGFTHVEFMP
LEEYPYLGSWGYQVTGYYGVDSRLGSPDDFKYLVDKLHEAGIGVIMDWVPAHFPKDAFAL
GRFDGTPLYEDPDPTRGEHPDWGTYIFNFGRREVRNFLVADACFWLDEYHMDGLRVDAVS
SMLYLDYSRQPGQWHPNKFGGRENLEAIDFIKEANATAYKNNPGIMMIAEESTAYPGVTA
PTDQGGLGYGLKWNMGWMHDTLEYLHEQPINRKWHHNEITFSMVYAYSEHYVLPISHDEV
VYGKGSLFGKMPGDDWQRYAGVRSLFAYQWAHPGKNLTFMGNELAQYGEWDYNSQLDWDC
LNWPDHRGVQQLVADLNALYKKSPALWSQDFTPDGFQWLTSDDSDHNTLSFVRIGKNGEQ
MVVVVNFSGTAWQDYQVALPQGGRWREVLTTDDRKYGGSDIHNTNIEANAGPYHSRDYST
KITVPALGVVFLEPDNN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
gtggatcatgcccaactcggcaccgtgagcgagggtcgtttctacaaccctcacgagatt
ctcggcgcccacctcggtagcggtgaatacagcgacaccgccaccgtccgcgtacttcgc
cctgacgccaaggaagtcgtcatcgtcacccccgacagcgagaccaaggccgaaccggaa
ctcaacggcgtctatgtcgccgtggttcccgccgtgaaaaccgacagggggtattcggtt
cccgactaccgcctgcgcatcaccaaggaggacggctccacggtggtggagaacgacccg
tatcgatacctgccgaccgtgggtgagatggatctctacctgttcggcgaaggacgccat
gaacgcctatgggaggccatgggcgccaacgtcaagcgatatgaggactccatgggtggc
aatgatggcacccatggcgaacctgtggtcggcactgcattcaccgtctgggcgccgaat
gcacattcggtgcgagtggtgggcgatttcaacggatggaacggcatctgccattcgatg
cgcgaactcggctcctccggcgtctgggaaatctttatcccgggtgtgacggccggcgag
aaatacaaatatcagattctcaacgtattcaacacttgggagatgaaggccgacccaatg
gaacgctcgcacgaggtgccaccgaagacggcctcgattgtggtggagtccgaataccat
tggaacgattccgactggatggccaagcgcgcgaaaaccgacccgcaccagggtcccgtg
gcgatctacgaggtaaatgcgaacagttggcgtgacgacgtacacagctaccgcgagctt
gccgacaagctcgtgccgtacgtcgcgaagctgggcttcacccacgtggaattcatgccg
ttggaggaatacccgtacctcggcagctggggctatcaggtgaccggctattatggcgtg
gactcccgcctgggctcccccgacgacttcaagtatctcgtcgacaagcttcacgaggcg
ggtatcggtgtaatcatggattgggtcccggcgcacttcccgaaggacgccttcgcattg
ggccgtttcgatggaacgccattgtatgaggacccggatccgacccgcggcgagcatccg
gattgggggacgtacatcttcaacttcggccgccgcgaggtgcgcaacttcctggtggcc
gacgcctgcttctggcttgatgagtaccatatggacggcctgcgcgtcgacgcggtctcc
tcgatgctctacctcgactacagccgtcaacccggtcaatggcatccgaacaagttcgga
ggacgcgagaacctcgaggccatcgacttcatcaaggaggccaacgccacggcctacaag
aacaatccgggcatcatgatgatcgccgaggaatccactgcctacccgggcgtcaccgcc
ccgaccgaccagggcggtctgggttatggactcaaatggaacatgggctggatgcacgat
acgcttgaatacctgcacgagcagccgatcaaccgcaagtggcaccacaacgagatcacg
ttctccatggtctacgcctattcggagcattatgtgctgccgatcagccatgacgaggtg
gtgtacggcaaaggatcgctgttcggcaagatgccgggcgacgattggcagcgctacgcc
ggcgtgcgttccctgttcgcctatcaatgggcacatccgggcaagaacctcaccttcatg
ggcaatgaactcgcacagtacggtgagtgggactacaacagccagcttgactgggactgc
ctgaactggcctgatcaccgtggcgtgcagcaactggtggccgacctcaacgctctgtac
aagaagtctccagccctgtggagccaggacttcacccccgacggtttccagtggctcacc
agtgacgattcggaccacaatacgttgagcttcgtgcgaatcggcaaaaacggcgagcag
atggtcgtcgtggtcaacttctccggaacggcatggcaggactaccaggtggcgctccca
caaggcggccgttggcgggaggtactcaccactgacgacaggaagtacggcgggtccgac
atccacaacaccaatatcgaagccaacgccggcccctaccattcgcgcgattattctacg
aagataaccgtgccggccctcggtgtcgtattcttggaaccggataacaactga

DBGET integrated database retrieval system