KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_1025Help
Entry
Balat_1025        CDS       T00924                                 

Definition
B-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Balat_1025
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Balat_1025
Enzymes [BR:blt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Balat_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1174282..1175721
Genome map
AA seq 479 aa AA seqDB search
MPRFVKVSARFARSTLLSVASGAPPAAICARELYNDSSHRRNRGPMIQHNDKPQPNRNRR
MVRIVTTVIVTLAIVAIAIGAFAPVRHATDSDTTNGKAAPTSVPSRTSSPAPSTTISMPQ
TASPSPTPKTDGTSDRAKRIVEAMSLDERAGQLVMAALQYGNDPATLQAMIQEQHVGNVI
LMGNWVSGVENVARATQALQRLNASTGLPGLLIATDQEGGTVQHLSGPGFDAMPSATAQG
QMPLDRLRAAARDWALPLKRSGLAMNLAPSVDTVTIERAVNEPIGALYRDFGLDAQRNGE
HAAAFIEGMRAGGVGSAIKHYPGLGSVRGNTDFTANGIVDDTTTENGTEVNAFTSAIRQG
KPAMVMVSLATYKLIDPDNPAAFSPAIVTDMLRRGTPFDGVVISDSLSAGAVSSIAPQDL
GVRFIDAGGDICCMNAASYTQPILDGIRSRAAADKGFAAKVTASAERVVRLKIELGLVQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcttcgtcaaggtgtctgcgcgcttcgcgcgtagcacgctcctcagcgtggca
tccggcgccccaccggcggcaatctgtgcccgcgaactgtacaatgacagcagccatcgc
agaaaccgaggacccatgatccagcacaacgacaagccacagccgaaccggaacaggcgc
atggtccggattgtcacgaccgtcatcgtgacattggcaatcgtcgccattgcgattggg
gcattcgcaccggttcgccatgctaccgattccgacacgacgaatggcaaagccgccccg
acatcggttcccagccgcacatcatcgccagcccccagcacgaccatttccatgccgcag
acagcgtcgccttcgcccacccccaagacggatggcacctcggatcgggccaaacgcatt
gtagaggcgatgagcctcgacgaacgcgccgggcaattggtgatggccgcattgcaatac
ggcaatgaccctgccaccttgcaagcgatgattcaggagcagcatgtggggaacgtgatc
ctgatgggcaactgggtgagcggcgtcgagaacgtggcgcgtgccacacaggcactgcag
aggttgaacgcctccaccggattgccaggattgctcatcgccaccgatcaggagggcggc
acggtccagcatctttcgggaccgggattcgatgccatgcccagcgccacggctcagggt
cagatgccactcgaccggctgcgcgcagccgcgcgggattgggccctccccctcaaacgg
tccggtctcgccatgaatctggctccttcggtggacacggtgacgatcgaacgtgccgtc
aatgaaccgatcggcgcgctctaccgtgatttcggactcgatgcccagcgcaatggcgag
catgctgcagctttcatcgaaggcatgcgcgccggcggtgtgggcagtgccatcaagcat
tacccgggattgggatcggtgaggggcaacaccgatttcacggcaaacggcattgtcgac
gacacgacaaccgagaacggcacggaggtgaatgcattcacctctgcgatccggcagggc
aaacccgccatggtgatggtgtcgctggccacctacaaactcatcgaccccgacaatcct
gcagccttctcccccgccatcgtcaccgacatgctgcgcagaggtaccccgttcgacggc
gtggtgatctcggattccctctcggccggtgccgtgagctcgattgctccacaggatctg
ggcgtgcggttcattgatgcgggaggggacatctgctgcatgaacgccgcaagctatacg
cagccaattctggacggcatacgcagccgcgctgccgcggacaagggttttgccgccaag
gtcactgcgagtgccgaacgcgtggtgagactgaaaatagagctcggcttggtgcagtga

DBGET integrated database retrieval system