KEGG   Bifidobacterium animalis subsp. lactis DSM 10140: Balat_1617Help
Entry
Balat_1617        CDS       T00924                                 

Definition
dimethyladenosine transferase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
blt  Bifidobacterium animalis subsp. lactis DSM 10140
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Balat_1617
Enzymes [BR:blt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Balat_1617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1919605..1920561
Genome map
AA seq 318 aa AA seqDB search
MSAPNGARFQTPTLRADYASVHVDCPAKTNLTLHVGERREEWGGRHALETIYCGVGIYDT
VTVTAKEPGTGFSLDLAGTHLGDLAASTSDMRRNHAVLAMFAMAQASGHEPDVSISIEKR
IPVAAGLGGGSADAAGTLLALNALWNLNWPVARLREIAAALGADMPFCVTGGLALGTGFG
ERIKDLTASDPRIEHAVGDLFADAPSGDGVHMLVGAYLSQLSTPEVYSTFDVLGAGEGDL
NELQHAAVSLHPRSGVAIREAQQAGATSAFVSGSGPTVIAVVPDDRVREATRAAWQASGA
VDRIIDAQAPAAPLMRAE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacccaacggcgcccgattccagacccccacgctccgcgcagactacgccagc
gtgcatgtggactgccctgccaagacgaatctcacattgcatgtgggggaacgccgtgag
gaatggggcggcagacatgccttggagaccatctactgcggcgtgggtatctacgacacg
gtgacggtgaccgccaaggaaccgggcaccggcttctccctcgatctcgccggcactcat
ttgggagatctggccgcgtcgacgagcgatatgcgcaggaaccacgccgtgcttgccatg
ttcgcgatggcgcaggccagcgggcacgaacctgacgtctccattagcatagagaagcgc
attcccgtcgcagccggtctgggaggcgggtcggcggatgcggcgggcacactgctcgcg
ctcaatgcgttgtggaatctcaattggccggtggcacgactccgcgagatagcggccgcc
ttgggcgccgacatgccgttctgcgtcaccggcggcctggcgttgggcaccggcttcggc
gagcgtataaaggatctgaccgcatccgacccgcgtatcgaacatgcggtgggcgatctg
ttcgcagatgccccttccggcgatggcgtgcacatgctcgtcggcgcatacctgtcgcag
ctgagcacgccagaagtctactccaccttcgacgtgctcggcgcaggagaaggcgacctc
aacgagttgcagcacgccgccgtctcgctgcatccgcgcagcggcgtggccatccgcgaa
gctcagcaggcgggcgcgacgagtgccttcgtctccggatctggccctactgtaatcgcc
gtggtgcctgacgaccgggtgcgcgaggcgacgcgcgcggcatggcaggcttccggggcc
gtcgaccgcatcatcgatgcacaggcaccggccgcaccgctcatgcgagccgagtag

DBGET integrated database retrieval system