KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_0050Help
Entry
BalV_0050         CDS       T01843                                 

Definition
glycoside hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blv00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BalV_0050
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BalV_0050
Enzymes [BR:blv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BalV_0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
53714..55240
Genome map
AA seq 508 aa AA seqDB search
MMKALKTTVHYDVTAGRTHTEQTELSVMDEAMNTEHIVESNVVGIYPDYTFQMMEGYGCS
LTESACYLLSKMDSATRKEALAQWFGPAGMDAWFVRVHIDSCDYSLSEYQAVEDPLADPE
LETFSIDRDRQYILPVLKEAMAMAGHPIHVLLSPWSPPAQWKTPPEMTRNDASVYGGEEG
DVIDLSKPGRCFGGRLKPEYYSSWARYLVRFISAYMAEGVPVTMLSIQNEAAAATSWDSC
LWTGDQEREFLKHHLYPAMEEAGLTDAVKIFIWDHNKERAIEHIDEFMSDPEAAKEVGGF
AYHWYSGDHFEALSMLRGKYPDKVLMHSESCGLHIPGKVTMLDMTDEQIEALPDGDYKTM
VQTTTPNEMDFNDATAYAHDIIGDLNHGMQRWIDWNMIVDRQGGPRHTPGGFAAPIVAED
DGRYTLTISYRYIREIAQAIKPNAVVLGTSTYSRDIEAVSARNADGSIGVVLLNQAERDI
PVNIRMGGLLVADVPLPARTLSTLVFTE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaggcgctcaagaccactgtgcactacgatgtgaccgccgggcgaacccatacc
gagcagacggagctctcggtcatggacgaggcgatgaacaccgagcacatcgtcgaatcg
aatgtggtgggaatctacccggactacacgttccagatgatggagggctatggttgctcg
ctcaccgagtcggcatgctatctgctctccaaaatggactccgcgacgcgcaaagaggcc
ttggcccaatggttcggtcccgctggaatggacgcttggttcgtccgcgtacacatcgac
tcctgtgattactcgctcagtgagtaccaggccgttgaggatcctctggccgatcccgaa
ttggagaccttctcgattgaccgtgatcgtcagtacattcttccggtgctcaaagaggcg
atggccatggcggggcatcccattcatgtgttgctctccccatggtcgcctccggcgcaa
tggaagacgcccccggagatgacgcggaacgacgcctcggtgtacggcggcgaggagggc
gatgtcatcgatctgagcaagccggggcgctgtttcggcggaaggctcaagccggaatac
tattcgtcgtgggcgcggtacctcgtcagattcatcagcgcctatatggccgaaggtgtt
ccggtgacgatgctgtcgattcagaacgaggcggctgcggccacgagttgggatagctgc
ctgtggaccggagatcaggagcgcgaattcctgaagcaccatctctacccggcaatggag
gaggccggtctgaccgatgccgtgaagatcttcatctgggatcataacaaggaacgtgca
atcgaacacatcgacgagttcatgagcgacccggaggcggcgaaggaggttggcggtttc
gcttatcactggtactccggcgaccatttcgaggcgctgtcgatgttgcgaggcaagtat
cccgacaaggtgctgatgcattccgaaagctgtgggctgcatatacccggcaaggtgacc
atgctcgatatgaccgatgaacagatcgaggcgctgcccgatggcgactacaagaccatg
gtgcagacgaccactccgaacgagatggacttcaatgatgcgacggcctatgcccacgac
atcatcggcgacctgaaccatggaatgcagcggtggatcgactggaacatgatcgtcgac
aggcagggtggtccccgtcataccccagggggtttcgccgcgccgatcgtcgccgaagac
gacggacggtatacgctgaccatcagctaccggtatattcgcgagattgcacaggccatc
aaaccgaatgcggtggttctcggcacaagcacgtattcgcgtgatatcgaggcggtctcg
gcccgcaacgcagatggctcaatcggcgtcgtcctccttaatcaggcggagcgcgatatc
ccggtgaacattcgcatgggcggcctgcttgtggcggatgtgccgttgccggcacgcacc
ttgagtactctggtgttcacggagtga

DBGET integrated database retrieval system