KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_0291Help
Entry
BalV_0291         CDS       T01843                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BalV_0291
  Amino acid metabolism
   00300 Lysine biosynthesis
    BalV_0291
Enzymes [BR:blv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BalV_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
366799..368019
Genome map
AA seq 406 aa AA seqDB search
MQDVIDRAGEPLKLTVDAGVGEQAALTDLCMQVMRVYSVSDDETHLTDMTEAFLRTLPHL
DVQRHGDTLVARTNLGRDRRVVLAGHLDVVPVIDNFPPKLLEPGDPLILPGVAEAHPGER
VVWGRGATDMKSSDAVLLYLAATLTNPKYDLTYVFYDHEEVAAEKNGLRKVAEAHPDWIA
GDFAIIGEPTSCGIEGGCNGTIRFDVVTHGIAAHSARAWMGHNAIHDAAEILRRLNEHTD
ATVSVDGLVYREGLNATLISGGKGTNVIPDECRVHVNYRFAPDKSLAEAKALMMGADCGA
ELGNGEHQATGGVFEGFGIEMKDESPSARPGMDSELTRSLAALAKARTGKDPEAKLGWTD
VARFSQLGVPAVNFGAGSPLLAHKHDEQVAEGELTLMAGILRDWLS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtgatcgatcgcgcgggggagccgctcaagctgacggtggacgccggtgtg
ggcgagcaggccgcgctcaccgacctgtgcatgcaggtgatgcgcgtgtactcggtgagc
gacgacgagacgcatctgaccgacatgaccgaggcgttccttcgcacgctgccgcatctg
gacgtgcagcggcatggcgacacgctcgtcgcgcgcacgaatctcggccgtgacaggcgc
gtggtgctcgccggccatctcgatgtggtgccggtgatcgacaacttcccgccgaaactg
ctcgaacccggagacccgctcattctgccgggcgtcgcggaggcgcacccgggcgaacgc
gtggtgtggggacgtggcgccaccgacatgaaatcgtcggacgccgtgctgctttacctt
gccgcgacgctgacgaacccgaaatacgatctgacttacgtgttctacgaccacgaggag
gtggccgccgagaagaacggcctgcgcaaggtcgccgaagcgcacccggactggatcgcc
ggcgatttcgcgatcataggcgagcccacctcatgcggcattgaaggcggctgcaacggc
acgatccgcttcgacgtggtcacgcacggcatagccgcacattccgcacgcgcgtggatg
ggccacaacgccatccacgacgccgccgagattctgcgccgtctgaacgagcatacggac
gccactgtgagcgtggacggtctcgtctaccgcgaagggctcaacgcgacgctgatcagc
ggcggcaagggcaccaatgtgatccccgatgaatgccgcgtgcacgtcaactaccgtttc
gctcccgacaaatcgctcgccgaggcgaaggcgctgatgatgggcgcagactgcggtgcc
gaactcggcaacggcgagcaccaggcgacgggcggtgtgttcgagggcttcggcattgag
atgaaagacgaatcgccgtcggcacgacccggcatggattccgaactcacgcgctcgctg
gcggctctggcgaaggcacgcaccggcaaggaccccgaggcgaagctcggctggaccgac
gtcgcccgattctcgcagctcggtgttccggccgtcaacttcggcgccggttcgccactg
ctcgcgcacaagcacgacgagcaggtggcggaaggcgaactgacgctcatggccggcatt
ctgcgcgactggctgagctga

DBGET integrated database retrieval system