KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_0667Help
Entry
BalV_0667         CDS       T01843                                 

Definition
polyphosphate glucokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:blv01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:blv00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:blv00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
813634..814404
Genome map
AA seq 256 aa AA seqDB search
MIDTAQAFGVDIGGSGIKAAPVNLEKGEFAEPRLKILTPEHSTPKAVGDIVRQQLEHFEV
PEDVPVGIAFPAPIKPGKKLDFMANLDQSWIGVDVTEVFSEACGRPVTVVNDADAAGLAE
QAFGAAAGQDGLVIATTLGTGIGTALIYDGVLIPNTELGHIQLPKGKGDAEKYAASSVRE
KLDMGYRKWAKRLTKYYGLMELYFSPELFVVGGGVSRVSEKFLPYIDIKTPIVAAKLHNE
AGIVGAAYYANQQSAK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgattgacactgcacaagcattcggcgttgacatcggtggctcgggcatcaaggccgct
ccggtgaatctggagaagggcgaattcgccgaaccccgcctgaagatcctcactccagag
cattccactcccaaggctgtgggagacattgtgcgccagcagctcgagcatttcgaagtg
cccgaggacgtaccggtgggaattgcgttcccggccccgatcaagccgggtaagaagctc
gacttcatggcgaacctcgatcagtcgtggattggtgtggacgtgaccgaggtgttctcc
gaggcatgcggccgtcctgtcaccgtggtcaacgacgcggacgcggccggtctggcggaa
caggcgttcggtgcggcggcgggccaggatgggcttgtcatcgccaccaccctcggcacc
ggcatcggtaccgccctgatctacgatggcgtgctcatccccaacaccgagctcggccac
atccaactgccgaagggcaagggcgatgcggagaagtatgcggcatcctcggtccgtgag
aaactcgacatgggctacaggaagtgggccaagcgcctcaccaagtactacggtctcatg
gagctgtacttcagccccgagttgttcgtggtcggcggtggtgtgagccgcgtctccgag
aagttcctgccgtacatcgacatcaagaccccgattgtcgccgccaagctgcataacgag
gcgggcatcgtgggtgccgcctactacgccaaccagcagtcggccaagtag

DBGET integrated database retrieval system