KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_0722Help
Entry
BalV_0722         CDS       T01843                                 

Definition
(GenBank) hypothetical protein
  KO
K22306  
glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Brite
Enzymes [BR:blv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     BalV_0722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
879622..880254
Genome map
AA seq 210 aa AA seqDB search
MQGSIDIPLDEVGLWQVNQSAQSLIKLYVLPDPSRHQLVVSSDLERSMQTAHAFADRLGS
EVHADERLRERHFGEFEGRSGAYLQANFPQDFDSWCRGMGGEMNHGAESHEHAGVRSMEA
MNDWAHECDDDTDLFVFSHGALIENALQVLFGIERRYPDFTLTSMCNAHWARLRRADIDM
DSRWIMEDYNHGPALADTQYWERPDTLPAK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgcagggatcgatcgacattccgctcgatgaggtcgggctgtggcaggtgaaccagtcc
gcgcagtcactgattaagctatatgtgctcccagacccatctcggcaccagctcgttgtg
tcctccgacctcgaacgttcgatgcagacggcacatgccttcgccgatagactggggtcc
gaagtgcatgccgacgaacggttgcgcgagcggcatttcggtgaattcgaaggccgatcc
ggcgcatacctgcaggccaatttcccgcaggacttcgactcgtggtgccggggcatgggc
ggcgagatgaatcatggcgccgaatcccacgaacatgccggtgtccgcagcatggaggcc
atgaatgattgggcccatgaatgcgatgacgacaccgacttgttcgtattctcccatggc
gcgctcatcgaaaacgcgctgcaggtgctgttcggcatcgaacgacgatacccggatttc
acgctcacctcgatgtgcaacgcgcactgggccagactgagaagggccgatatcgacatg
gacagccggtggatcatggaggactacaaccatggacccgccctggccgatacacagtat
tgggagcgcccagacactttgccagcgaaatga

DBGET integrated database retrieval system