KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_0725Help
Entry
BalV_0725         CDS       T01843                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BalV_0725
   01230 Biosynthesis of amino acids
    BalV_0725
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BalV_0725
  Energy metabolism
   00680 Methane metabolism
    BalV_0725
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BalV_0725
Enzymes [BR:blv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BalV_0725
Exosome [BR:blv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BalV_0725
  Exosomal proteins of melanoma cells
   BalV_0725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
882257..883081
Genome map
AA seq 274 aa AA seqDB search
MIDEVMFMRHGRTAFNLQRRLQGQIDIPLDIVGQWQVDMSGFTLAQRFYWAKVSNIARHP
DRLSQPSDPPIRRSDITEYEQAPASRRRMVVVSSDLFRAQQTAHAFADPLGLDVTLDSRL
RERDFGQWEGMSREEINERYPEGYASWKAHEGGEAAYGVESRPDLGKRGSSTIRSYCDDP
QYMDEPTTLFVVSHGSWIAATIGNLMGLPDSQLDNLTGMRNAFWSRMEPQYTSNSVLFHL
TEYDKGPDVADAVDWENGPAYLRNPDMPMWKPLI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgaagtgatgttcatgcgccacgggcgcaccgcattcaatttgcaacggcgc
ttgcaggggcagatcgacattccactcgatatcgtggggcagtggcaggtggatatgagc
ggattcacactcgcccaacggttctattgggccaaggtgtcgaatatcgcccggcatccg
gacaggctttcccagccctccgatcccccgattcgtcgcagcgacatcacggaatatgag
caagcccctgcgtcgcgacgccgcatggtggtcgtgagctcggatctcttccgggcccaa
cagacggcccatgctttcgccgacccgctgggattggacgtgacactcgattcgcgtctg
cgcgaacgtgatttcggccaatgggaagggatgagccgagaggagattaatgagcggtac
ccggaaggatatgcgtcgtggaaggcccatgagggcggcgaggcggcctatggggtggaa
agccgtcccgaccttggcaaacgtggcagttccacgatccgttcctattgcgacgacccc
cagtacatggatgagcccaccacgttgttcgtcgtctcccacggttcatggatcgccgca
accattggaaacctcatgggtctgccagattcgcagcttgacaatctgaccggtatgcgc
aatgcgttctggagtcgtatggaaccccagtacacttcgaattccgtgctgttccatctt
acggaatatgacaaggggccggatgtggcggacgccgttgactgggagaacggcccggcg
tacctgcgcaatccagacatgccgatgtggaaaccgctgatttag

DBGET integrated database retrieval system