KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_0725Help
Entry
BalV_0725         CDS       T01843                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Pathway
blv00010  Glycolysis / Gluconeogenesis
blv00260  Glycine, serine and threonine metabolism
blv00680  Methane metabolism
blv01100  Metabolic pathways
blv01110  Biosynthesis of secondary metabolites
blv01120  Microbial metabolism in diverse environments
blv01130  Biosynthesis of antibiotics
blv01200  Carbon metabolism
blv01230  Biosynthesis of amino acids
Module
blv_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BalV_0725
  Energy metabolism
   00680 Methane metabolism
    BalV_0725
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BalV_0725
Enzymes [BR:blv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BalV_0725
Membrane trafficking [BR:blv04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BalV_0725
Exosome [BR:blv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BalV_0725
  Exosomal proteins of melanoma cells
   BalV_0725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADG33313
Position
882257..883081
Genome map
AA seq 274 aa AA seqDB search
MIDEVMFMRHGRTAFNLQRRLQGQIDIPLDIVGQWQVDMSGFTLAQRFYWAKVSNIARHP
DRLSQPSDPPIRRSDITEYEQAPASRRRMVVVSSDLFRAQQTAHAFADPLGLDVTLDSRL
RERDFGQWEGMSREEINERYPEGYASWKAHEGGEAAYGVESRPDLGKRGSSTIRSYCDDP
QYMDEPTTLFVVSHGSWIAATIGNLMGLPDSQLDNLTGMRNAFWSRMEPQYTSNSVLFHL
TEYDKGPDVADAVDWENGPAYLRNPDMPMWKPLI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgaagtgatgttcatgcgccacgggcgcaccgcattcaatttgcaacggcgc
ttgcaggggcagatcgacattccactcgatatcgtggggcagtggcaggtggatatgagc
ggattcacactcgcccaacggttctattgggccaaggtgtcgaatatcgcccggcatccg
gacaggctttcccagccctccgatcccccgattcgtcgcagcgacatcacggaatatgag
caagcccctgcgtcgcgacgccgcatggtggtcgtgagctcggatctcttccgggcccaa
cagacggcccatgctttcgccgacccgctgggattggacgtgacactcgattcgcgtctg
cgcgaacgtgatttcggccaatgggaagggatgagccgagaggagattaatgagcggtac
ccggaaggatatgcgtcgtggaaggcccatgagggcggcgaggcggcctatggggtggaa
agccgtcccgaccttggcaaacgtggcagttccacgatccgttcctattgcgacgacccc
cagtacatggatgagcccaccacgttgttcgtcgtctcccacggttcatggatcgccgca
accattggaaacctcatgggtctgccagattcgcagcttgacaatctgaccggtatgcgc
aatgcgttctggagtcgtatggaaccccagtacacttcgaattccgtgctgttccatctt
acggaatatgacaaggggccggatgtggcggacgccgttgactgggagaacggcccggcg
tacctgcgcaatccagacatgccgatgtggaaaccgctgatttag

DBGET integrated database retrieval system