KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_0761Help
Entry
BalV_0761         CDS       T01843                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Pathway
blv00260  Glycine, serine and threonine metabolism
blv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
blv01100  Metabolic pathways
blv01110  Biosynthesis of secondary metabolites
blv01130  Biosynthesis of antibiotics
blv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BalV_0761 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BalV_0761 (trpA)
Enzymes [BR:blv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BalV_0761 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA GDPD
Motif
Other DBs
NCBI-ProteinID: ADG33349
Position
919622..920491
Genome map
AA seq 289 aa AA seqDB search
MTEYNTTPSGQPLGISHRPSPCRELFTRFKAQDKPAFIGYLPFGFPTMEQSLEAFATMVE
NGADIVEIGLPYSDPVMDGPVIQAASQIALNNGERIADVFKAVETVANAGGVPLIMSYWN
LIYHYGVERFAADFANAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSTDERLR
VVCENARGFVYAASRMGVTGERSSLGTSPEDLVARTRKAGAENVCVGIGVSTAAQGKAVG
QYADGVIVGSALVHTLLTEDGDARELTSGLAALAAKTAELAEGIHNARL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatacaacaccacgccaagcggtcagccgcttggaatcagccatcgtcccagc
ccatgccgcgagctgttcacacggttcaaagcgcaggacaagcctgcattcattgggtac
ctgccattcggattccccacgatggaacagtcactcgaggccttcgccacgatggtcgag
aacggtgctgacattgtcgagataggactgccgtattccgatccggtgatggatggcccg
gtgatccaggccgccagccagatcgccctgaacaatggcgagcgcatagccgatgtgttc
aaggccgtggagacggtggccaatgccggtggagtgccgctcatcatgagctactggaac
ctcatctaccattatggggttgaacgcttcgccgctgatttcgcgaatgcaggaggcgca
ggccttatcactcccgatctcattcccgacgaggcaggggagtggatcgaggcgtcggac
cgccatgggctcgatcgcatcttccttgtttcccccgactccaccgatgagcgtctgcgg
gtggtgtgtgaaaacgcccggggattcgtctatgcggcatcgcgcatgggcgtgactggc
gaacggtcgagtctagggacttccccggaggatcttgtggcccggacccgtaaggccggg
gccgagaatgtgtgtgtgggcatcggcgtctccaccgctgctcaaggcaaggccgtcggg
cagtatgcagacggggtcatcgttggatccgccttggtccacaccctgctcaccgaggat
ggcgatgcgcgcgagctcacctcaggtctggctgcgttggcggccaagaccgcagaactc
gccgagggcatccacaacgcacgcctgtag

DBGET integrated database retrieval system