KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_0792Help
Entry
BalV_0792         CDS       T01843                                 

Definition
holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:blv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BalV_0792
Enzymes [BR:blv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BalV_0792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(949313..949936)
Genome map
AA seq 207 aa AA seqDB search
MIGMLKGRVESVDTSNAVVDVHGVGFELRMPSNDLTAMHMGQDVKIYTSMSVSQDAITLF
GFLDARSKRMFLQLQKVSGVGPKVALSLLSTLAPDDLAQAIHDGDDKALSRAPGLGRKGA
QKIILELKGSIDVDKIETGEPTSTQRIPTDKGVEQVVEGLMSLGWKQADAQQAVDSVISS
SGIALPLEEGNVPTVLRLALTSLDRGR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatcggaatgctcaagggccgggtcgagtcggtggacacttccaatgcggtggtggac
gtccatggggttggattcgaattgcgtatgccttccaacgatctcaccgccatgcatatg
ggccaggacgtcaaaatatacacatccatgagcgtctcgcaggacgccatcacgctgttc
ggattcctcgacgccagatcgaaacgcatgttcctccagctgcagaaggtgagtggcgtc
ggaccgaaggtggcgctttcgcttctgagcacgctggcccccgacgaccttgcacaggca
atccacgacggtgacgacaaggccttgtcacgcgcccccggtctgggccggaaaggtgcc
cagaaaatcatcctggagctcaagggctcgattgacgtcgacaaaatcgaaacaggggag
ccaacttccacgcaacgcatcccaaccgacaagggggtcgaacaggtggttgagggtctc
atgtcgctgggctggaagcaggcggatgcacagcaggctgtggattcggtcatttcctcc
agtggcatcgcgttgccactggaggaaggcaatgtgccgactgtgctcagactggcattg
acatcactggacagagggaggtaa

DBGET integrated database retrieval system