KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_0813Help
Entry
BalV_0813         CDS       T01843                                 

Definition
bifunctional HTH-domain-containing protein/aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blv00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    BalV_0813
   01230 Biosynthesis of amino acids
    BalV_0813
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BalV_0813
   00290 Valine, leucine and isoleucine biosynthesis
    BalV_0813
Enzymes [BR:blv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BalV_0813
    2.6.1.66  valine---pyruvate transaminase
     BalV_0813
Amino acid related enzymes [BR:blv01007]
 Aminotransferase (transaminase)
  Class I
   BalV_0813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(971311..972990)
Genome map
AA seq 559 aa AA seqDB search
MTDFTTRLNQAMELRNIKQIDFVKAAQDHGVKLGRSHISQYVSGKTRPRRDIERFLAAVL
RVNADWLAGESVPFDDDPETFAKIEHVSPDADFEHIKRVEQNSSIQNSEHIEHNNELAEI
EQEQDMEAAANNNVQDPSFPDVPSSVTSEPMNIGSRRVFTKSHKLDNVLYDVRGPVVNEA
ARMEAAGMHVMKLNIGNPAPFGFRTPDEVVYDMAQQLTDTEGYSASKGLFSARKAIMQYA
QLKNLPNVGVEDIYTGNGVSELINLSMSALLDDGDEVLLPAPDYPLWTACVTLAGGKPVH
YVCDEQSEWYPDIDDMRAKITDRTKAIVIINPNNPTGALYPTEVLQQIVELARQHQLMIF
SDEIYDRLVMDGLTHTSIASLAPDLFCVTYSGLSKSHMIAGYRIGWMILSGNKSIAKDYI
EGLDMLTNMRICSNVPAQSIVQTALGGHQSVNDYLVPGGRIYEQREYIYNALNSIDGITA
VKPKAAFYIFPKIDAKKFNIRNDEQFALDLLHDEKLLIVQGTGFNWKDPDHFRVVYLPRV
EVLKGAVDKMTHFFSHYRQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttcaccacgcgcctcaatcaggcgatggagttgcgcaacatcaagcagatc
gacttcgtcaaagcggcgcaggaccatggagtcaagctggggcgcagccacatcagtcaa
tatgtgagcggcaaaacaagaccgcgccgcgatattgagcgattcctcgcggctgtgttg
cgggtgaacgcggattggctggcaggcgagagcgtgccgttcgacgatgatcctgaaacc
ttcgcaaagattgaacacgtgagtccagacgccgattttgaacatatcaagagagttgaa
cagaatagttcgattcagaattctgaacatattgaacataacaatgaactcgctgaaatt
gaacaggagcaagacatggaagcggcagcgaacaataatgtgcaggacccctcgttccct
gatgtgccatcaagtgtcacatcggaacccatgaacatcggctcccgacgggtcttcacc
aagtcacataaactggacaacgtgctctatgacgtacgcggaccggtggtcaacgaggcg
gcgcgcatggaagcagccggcatgcatgtgatgaaactcaatataggcaatccagcccca
ttcggattccgtacaccggacgaagtcgtctatgacatggcacaacagctcaccgatacg
gaagggtattcggcgtcaaaggggctcttctcagcccgtaaggcgatcatgcagtacgct
cagctcaagaacctgccgaatgtgggagtagaagacatctacactggcaacggtgtgagc
gagctcatcaacctcagcatgagtgcgttgttggacgacggggacgaagtgctgctaccg
gcccccgactatccgttgtggacggcatgcgtcaccctggcaggcggcaaaccagtgcat
tacgtctgcgacgaacagtcggagtggtatccggacatcgacgatatgcgtgccaagatc
accgatcgcaccaaggcaatcgtcatcatcaacccgaacaatccgacaggcgcgctctat
ccgaccgaggtgctgcagcagatcgtcgaactggcgcggcagcaccagcttatgatcttc
tccgacgagatctatgaccgcctcgtcatggatgggctcacccacacgtcaatcgcctcc
ctcgcccccgacctgttctgcgtgacctatagcggtttgtcgaagtctcatatgatcgcc
gggtaccgcatcggctggatgatcctgtcaggcaacaagtcgatcgcgaaggattacatc
gaaggccttgacatgctcacgaacatgcgcatctgctcgaatgtacccgcccaatcaatc
gtgcagacggcattgggaggccatcagagtgtcaacgactacctcgttccggggggccgt
atatacgaacagcgtgaatacatctacaacgcgctgaactcaatcgatggcatcacggcg
gtcaaaccgaaggcggccttctacatcttcccgaaaatcgatgcgaagaaattcaacatt
cgcaacgacgagcaattcgcgctcgatctgctgcacgacgagaaactgctcatcgtgcag
ggcaccggtttcaattggaaggacccggaccatttccgtgtggtctacctgccgcgcgtc
gaggtgctcaaaggcgccgtcgacaaaatgacacacttcttcagccactatcgccaatag

DBGET integrated database retrieval system