KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_0958Help
Entry
BalV_0958         CDS       T01843                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:blv00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1136847..1139060
Genome map
AA seq 737 aa AA seqDB search
MDHAQLGTVSEGRFYNPHEILGAHLGSGEYSDTATVRVLRPDAKEVVIVTPDSETKAEPE
LNGVYVAVVPAVKTDRGYSVPDYRLRITKEDGSTVVENDPYRYLPTVGEMDLYLFGEGRH
ERLWEAMGANVKRYEDSMGGNDGTHGEPVVGTAFTVWAPNAHSVRVVGDFNGWNGICHSM
RELGSSGVWEIFIPGVTAGEKYKYQILNVFNTWEMKADPMERSHEVPPKTASIVVESEYH
WNDSDWMAKRAKTDPHQGPVAIYEVNANSWRDDVHSYRELADKLVPYVAKLGFTHVEFMP
LEEYPYLGSWGYQVTGYYGVDSRLGSPDDFKYLVDKLHEAGIGVIMDWVPAHFPKDAFAL
GRFDGTPLYEDPDPTRGEHPDWGTYIFNFGRREVRNFLVADACFWLDEYHMDGLRVDAVS
SMLYLDYSRQPGQWHPNKFGGRENLEAIDFIKEANATAYKNNPGIMMIAEESTAYPGVTA
PTDQGGLGYGLKWNMGWMHDTLEYLHEQPINRKWHHNEITFSMVYAYSEHYVLPISHDEV
VYGKGSLFGKMPGDDWQRYAGVRSLFAYQWAHPGKNLTFMGNELAQYGEWDYNSQLDWDC
LNWPDHRGVQQLVADLNALYKKSPALWSQDFTPDGFQWLTSDDSDHNTLSFVRIGKNGEQ
MVVVVNFSGTAWQDYQVALPQGGRWREVLTTDDRKYGGSDIHNTNIEANAGPYHSRDYST
KITVPALGVVFLEPDNN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
gtggatcatgcccaactcggcaccgtgagcgagggtcgtttctacaaccctcacgagatt
ctcggcgcccacctcggtagcggtgaatacagcgacaccgccaccgtccgcgtacttcgc
cctgacgccaaggaagtcgtcatcgtcacccccgacagcgagaccaaggccgaaccggaa
ctcaacggcgtctatgtcgccgtggttcccgccgtgaaaaccgacagggggtattcggtt
cccgactaccgcctgcgcatcaccaaggaggacggctccacggtggtggagaacgacccg
tatcgatacctgccgaccgtgggtgagatggatctctacctgttcggcgaaggacgccat
gaacgcctatgggaggccatgggcgccaacgtcaagcgatatgaggactccatgggtggc
aatgatggcacccatggcgaacctgtggtcggcactgcattcaccgtctgggcgccgaat
gcacattcggtgcgagtggtgggcgatttcaacggatggaacggcatctgccattcgatg
cgcgaactcggctcctccggcgtctgggaaatctttatcccgggtgtgacggccggcgag
aaatacaaatatcagattctcaacgtattcaacacttgggagatgaaggccgacccaatg
gaacgctcgcacgaggtgccaccgaagacggcctcgattgtggtggagtccgaataccat
tggaacgattccgactggatggccaagcgcgcgaaaaccgacccgcaccagggtcccgtg
gcgatctacgaggtaaatgcgaacagttggcgtgacgacgtacacagctaccgcgagctt
gccgacaagctcgtgccgtacgtcgcgaagctgggcttcacccacgtggaattcatgccg
ttggaggaatacccgtacctcggcagctggggctatcaggtgaccggctattatggcgtg
gactcccgcctgggctcccccgacgacttcaagtatctcgtcgacaagcttcacgaggcg
ggtatcggtgtaatcatggattgggtcccggcgcacttcccgaaggacgccttcgcattg
ggccgtttcgatggaacgccattgtatgaggacccggatccgacccgcggcgagcatccg
gattgggggacgtacatcttcaacttcggccgccgcgaggtgcgcaacttcctggtggcc
gacgcctgcttctggcttgatgagtaccatatggacggcctgcgcgtcgacgcggtctcc
tcgatgctctacctcgactacagccgtcaacccggtcaatggcatccgaacaagttcgga
ggacgcgagaacctcgaggccatcgacttcatcaaggaggccaacgccacggcctacaag
aacaatccgggcatcatgatgatcgccgaggaatccactgcctacccgggcgtcaccgcc
ccgaccgaccagggcggtctgggttatggactcaaatggaacatgggctggatgcacgat
acgcttgaatacctgcacgagcagccgatcaaccgcaagtggcaccacaacgagatcacg
ttctccatggtctacgcctattcggagcattatgtgctgccgatcagccatgacgaggtg
gtgtacggcaaaggatcgctgttcggcaagatgccgggcgacgattggcagcgctacgcc
ggcgtgcgttccctgttcgcctatcaatgggcacatccgggcaagaacctcaccttcatg
ggcaatgaactcgcacagtacggtgagtgggactacaacagccagcttgactgggactgc
ctgaactggcctgatcaccgtggcgtgcagcaactggtggccgacctcaacgctctgtac
aagaagtctccagccctgtggagccaggacttcacccccgacggtttccagtggctcacc
agtgacgattcggaccacaatacgttgagcttcgtgcgaatcggcaaaaacggcgagcag
atggtcgtcgtggtcaacttctccggaacggcatggcaggactaccaggtggcgctccca
caaggcggccgttggcgggaggtactcaccactgacgacaggaagtacggcgggtccgac
atccacaacaccaatatcgaagccaacgccggcccctaccattcgcgcgattattctacg
aagataaccgtgccggccctcggtgtcgtattcttggaaccggataacaactga

DBGET integrated database retrieval system