KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_1132Help
Entry
BalV_1132         CDS       T01843                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:blv00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:blv00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1355172..1356722
Genome map
AA seq 516 aa AA seqDB search
MSLSLQSAARELFAENLLHEIITPHMWTMNAASVENNEVPFTAITYDTRTVTPGSLLVCK
GNFNPKYLEQANKLGMAAYVATNDYSAYTDAPGLIVSDDKKALSILAQAYYDHPERQLTL
IGITGTKGKTTTAYYTHAIINALSGNTTALFSSVDNCVDGMHYVESDLTTPESLDAVRMM
REAVNNGMKYLVMEVSSQAYKVNRVYDFHFDVAAFLNISPDHISPIEHPSFENYLWCKRQ
IIRNADMLVLGERSDHEQLLLEDAELNRVPVSTFALADSPAQSDIADVTCAPTNMEHTAF
DYFVDGERLGSLTLAMEGDFNYANAAAALAIAHDIGMDVSDPRALASLADVRISGRMEEM
HDSRSNTLAIVDYAHNFASVNALLDFVEQRYGAEHPHITLITGSAGNKAYDRREGIVKAA
QDRVQKLILTAEDTDTEPIEQICSEMANNVTNEDLDVQTILDRAEAVKHAVDEARAADGG
LSILLLIGKGDEQWIKDRNIHTPYEGDSQIIRRLFA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgtcgttgcaatccgcagcacgcgagctcttcgcggagaatctgctgcatgag
atcatcaccccgcacatgtggaccatgaacgcggcctccgtagagaacaacgaggtgccg
ttcacggcaatcacctacgacacgcgcacggtgacgccaggcagtctgctcgtatgcaaa
gggaacttcaatccgaaatacctcgagcaggcgaacaagctcggcatggcggcgtacgtg
gcgacgaacgattattcggcgtacacggacgcgcccgggctcatcgtctccgacgacaag
aaagcactcagcattctcgcccaggcatactacgaccacccggagcgtcagctcacactg
atcggcatcaccggcaccaagggcaagaccaccaccgcgtactacacgcacgccatcatc
aacgcgctgagtggaaacacgacggcattgttctcgtcggtggacaattgcgtggacggc
atgcactacgtggaatccgacctcacgacgcccgaatcgctcgacgcggtgcgcatgatg
cgcgaggcggtgaacaacggcatgaaatacctggtgatggaggtctcctcacaggcatac
aaagtcaaccgcgtctacgatttccatttcgacgtcgccgcgttcctcaacatctccccc
gatcacatcagccccatcgagcaccccagtttcgagaactacctgtggtgcaagcggcag
atcatacgcaatgccgacatgctcgtgctcggcgagcgcagcgaccacgagcaactgctg
ctcgaggatgccgaactgaaccgcgtacccgtctccacgttcgcattggccgattcgccg
gcgcagtccgacatcgcggacgtcacctgcgcaccgaccaatatggagcacacggcattc
gactacttcgtggacggcgagcgtctcggcagcctcacgctcgcaatggagggcgacttc
aactatgcgaacgcggccgccgctctggcaatcgcgcatgacatcggcatggatgtgagc
gacccgcgtgcgctcgcctcactcgccgacgtacgcatctcgggacgcatggaggagatg
cacgacagcaggtcgaacacgctcgccattgtcgactacgcgcacaatttcgcctcggtg
aacgcgttgctcgatttcgtggagcagcggtacggcgccgagcatccgcatatcacgctg
atcaccggttcggccggcaacaaggcatacgaccgtcgcgagggaatcgtcaaagccgca
caggaccgcgtgcagaagctcattctcactgcggaggacaccgacaccgagcccatcgag
caaatctgcagcgagatggccaacaacgtgacgaacgaggatctcgatgtgcagacgatc
ctcgaccgtgccgaagccgtgaagcatgccgtcgacgaggcgcgtgcggcggacggcgga
ctgagcatcctgctgctcataggcaagggcgacgagcagtggatcaaggaccgcaacatc
cacacgccatacgagggcgactcgcagatcatccgacgtctgttcgcttga

DBGET integrated database retrieval system