KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_1486Help
Entry
BalV_1486         CDS       T01843                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:blv00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:blv00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:blv00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1815394..1817790)
Genome map
AA seq 798 aa AA seqDB search
MLEHSRPALLDELTAPRNALKPDSKGRIVWGNGTVTLVFAVSDDRPVTLIGMSGRGMEPV
DANIAGEPDAQPIVELRSSLDGGGDNRLKLAVSSAGLKLRFVRAYELNRLGDERQPVTLL
AIVQRDPDGDGPLVTSVFEATAHTSAVRTYTRLCSEEPYPVEAVSSMNATLPMEAAKLED
AQAQVYWGESSWDCENAWQSAPLRSTTLRDRNQVINPGMSSARFARRSTSTWSTGEFEPM
GIVEGGGRPGELGHFSFAWQIEHNGAWEWEIGEDDPGLRVSAYGPEYDDHQWFIMLRDNQ
PFVTVPVSFVVCAGDWQHAVAEMTVQRRALYRAKAMEMGRLEQAEQAKGLVVYNDYMNTL
WGDPRIEKELPLVEGAAKVGADVFCIDAGWYDSEDGGWWDMVGEWKPSMNRFGDIRLAGL
IHDIQSHGMKAGLWLEPEVIGVRSPLAKMLPDSAFFCRHGVRIADQGRYHLDFRSPVARA
HATATVDRLIDEFNVRFFKFDYNTTPGAGTDVDTDSVGEGLLEHCRAVQQWIEQIRAKHP
DVMIENCGSGAMRADYAMLSRLDMQSTSDQSDPLVYAAIAAGAGMTVLPEQQGNWGYAQQ
EMDDETAVFTLAAGILGRLYLSGFIDRMDEARLGLVRDAIALHRTILGGQSHLVPWWPCG
LPDFNSPWLVYGLRHAPNVTGLSHDEDWNGTDGQGSEHVDEAQYLTIWRRGGINSLYLEI
GEGAHIEQVFPNPAKPEHAPDAKPWRIEWADSETVRIEASADKEPSARVFAITFPQPSAD
GTADDDASENAGHDIEGR
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaacatagccgccccgcattgttggacgagttgacggcgccccgcaacgccttg
aagccggattcgaaagggcgcatcgtatggggcaacggaacggtgacgctcgtcttcgcc
gtgagcgacgacagaccggtgacattgatcggcatgagcggccggggcatggagccggta
gatgcgaacatcgccggcgaaccggatgcgcagccgatcgtggaactgcgcagttcgctt
gacggcggcggggacaacagactgaagctcgccgtttcgtccgccggcctcaaactgagg
ttcgtgcgggcatatgagctcaacagattgggcgatgagcgacagccggtcacgctgctc
gcgattgtgcagcgcgacccggacggggacggcccgttggtgacgagcgtgttcgaggcc
acggcgcacacgagcgccgtgcgcacctacacacggttgtgcagcgaggagccatatcca
gtggaggcggtgtcgtcgatgaacgcaacactgcccatggaagcggccaaactggaggat
gcgcaggcgcaggtctattggggagaaagctcgtgggactgcgagaacgcctggcaaagc
gccccgctgcgttccaccacgctgcgcgaccgcaaccaggtgatcaatccgggcatgtcc
tccgcccgattcgcccgccgttccacctcgacgtggtccaccggcgaattcgagccgatg
ggcatcgtcgaaggaggcggccgcccgggtgagctcggccatttctcattcgcatggcag
atcgagcacaacggcgcctgggaatgggagatcggcgaggacgacccgggtctgcgcgtg
agcgcatacgggccggaatacgacgaccatcagtggttcatcatgctgcgcgacaaccag
cccttcgtcacggtgccggtctcgttcgtggtctgcgcgggcgactggcagcatgccgtg
gccgagatgaccgtgcagcggcgcgcgctctaccgggcgaaggccatggagatggggcgt
ctggagcaggccgaacaggcgaagggtctcgtggtctacaacgactacatgaacacgttg
tggggagacccccgcatcgagaaggagctgccgcttgtggagggcgcggccaaggtgggc
gccgacgtgttctgcatcgacgccgggtggtacgacagcgaggacggcggctggtgggac
atggtgggtgaatggaaaccctccatgaaccgcttcggcgacatccgcctggccggcctc
atccacgacatccagtcacacggcatgaaggccggcctgtggctggagccggaggtgatc
ggcgtgcgctcgccgctggcgaagatgctgcccgactcggcgttcttctgccggcatggc
gtccgcatcgccgatcagggccgctaccatctcgacttccgctcgccggtggcgcgcgcc
catgccacggccacggtggaccgcctgatcgacgagttcaatgtgaggttcttcaagttc
gactacaacacgacgccgggtgccggcaccgatgtcgacacggattcggtgggcgagggc
ctgctcgagcattgccgcgcggtgcagcagtggatcgagcagatccgcgccaaacacccc
gacgtgatgatcgaaaactgcggttccggtgccatgagggccgactatgcgatgctgagc
cgcctcgacatgcagtccacctccgaccagtccgatccactcgtctatgcggcgatcgcc
gccggcgccggcatgacggtgcttccggagcagcagggcaactggggctatgcacagcag
gagatggacgacgagaccgccgtgttcacgctggctgcaggcattctgggccgcctgtac
ctctcggggttcatcgaccgcatggacgaggcgcggctgggcctggtgcgcgatgcgatc
gcactgcaccgcacgatcctgggcgggcaatcgcatctggtgccatggtggccctgtggg
ttgccggacttcaacagcccttggctcgtgtatggtttgcggcatgcccccaatgtgacc
gggctgtcgcatgacgaagactggaatggcactgacggccaaggctccgagcacgtcgat
gaggcccaatacctgaccatctggcgtcgtggcggcattaattcgctgtatttggagatt
ggtgagggagcccatatcgagcaggtgttccccaatccggccaagccggagcatgcgccc
gatgccaagccgtggcgcattgaatgggcggattccgagaccgtgcgcatcgaagcctcc
gcagacaaggagccctccgcacgtgtcttcgccatcacattcccgcagccatctgccgat
ggcacagcggatgacgatgccagcgagaacgccgggcacgatatcgaggggcgataa

DBGET integrated database retrieval system