KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_1515Help
Entry
BalV_1515         CDS       T01843                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BalV_1515
Enzymes [BR:blv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BalV_1515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1853174..1855372
Genome map
AA seq 732 aa AA seqDB search
MSQINSAPPRREESPERLARPLIQLAKGCGVATCYIDQLGTYVEIRDAVLISVLGALGVD
ASTPELVDINLNARRNEAHERLVAPTVVKFLGTPASTPLHTKHGEPHIGLTLEDGSDATD
ALSLTFREHDGDVDVYDLAIGDNLEIGYHTLHVRDGETGSERDVDVTLLCAPASIPVPEA
LASHKRWGWMTQMYSVRSPESWGVGDYGDLRELLVDAAGSGADFMLINPVHASAPVSPIE
PSPYSPMSRRFINTTYIRPQDIAEFAELDEQDAAAVRALHEQVAPMNTESSPMDLDAAWK
AKRAALQIIFRQPRSPERQASFEAFKEKAGADLDTWALWSVAFEVLGEPWEPDSWFRMTA
KSNPRIQALRTEHPDLYEFACWLQWIAEEQLDAAQRAARDAGMSLGLMQDMAVGVHSYGA
DAWGNPERFAVGSVTVGCPPDFYNQQGQDWGQPPLNPNYLELTGYRMYREMVHHMFEHAG
AIRIDHILGLFRLWWIPAGQGAKGGAYVTYNYDAMIAVLSIEATRVNGIVIGEDLGTVPD
FVRNVLARHGLLGTTVEWFARVDDSPNAGDPYAMPQTYRTYSLSSVTTHDLPPTAGYLML
EQVKLREELGLLTEPVEEFRESALAERQAMLDLLVQGGWMSQEAADDVPDNLQTIVEAMH
AMLTDAPSLLLQAALVDGVGEARAQNQPGTSTQYPNWRIPLADEHLKVVPTQEVFKSPRV
QALAKIMNRINQ
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagatcaattcagcacccccgcgccgtgaggaaagccccgagcgactcgcacga
ccgctcatccagctcgccaaggggtgcggtgtggccacctgctacatagaccagctcggc
acctatgtggagattcgcgacgcagtgctcatctcggtgctcggcgcgctcggcgtcgac
gcctccaccccggagctcgtcgacatcaatctcaacgcgcgacgcaacgaggcgcacgaa
cgcctggtggcgcccaccgtcgtcaagttcctcggcacccccgccagcacgccgctgcac
accaagcacggggagcctcacatcggactcacgctcgaagacggcagcgacgcgaccgat
gccctctcgctcaccttccgcgagcatgatggcgacgtggacgtctacgacctcgcgatc
ggcgacaatctggagatcggctaccacacactgcatgtgcgcgatggcgaaacgggcagc
gagcgcgacgtcgacgtcacactgttgtgcgcgccggcatccattccggtacccgaggcc
ctcgcctcgcacaagcgctggggatggatgacgcagatgtattcggtgcgctcccccgaa
tcgtggggcgtgggcgactacggggacctgcgcgaactgctggtggacgccgccggctcg
ggtgccgacttcatgctcatcaatccggtgcatgcgagcgcgccggtgagcccgatcgaa
ccgtcgccgtattcgccgatgtcgcgccgcttcatcaacaccacctacattcgcccgcag
gacatcgccgaattcgccgagctcgacgagcaggacgccgccgccgtacgcgcattgcac
gagcaggtcgcgccaatgaacaccgaatcgtcgccgatggatctcgacgccgcctggaag
gcgaaacgcgccgccttgcaaatcatcttcaggcagccgcgctccccggaacgtcaggcg
tcgttcgaggcgttcaaggagaaggccggcgccgacctcgacacctgggcactgtggagc
gtcgcattcgaagtgctcggggagccatgggagccggactcctggttccgcatgaccgcc
aaaagcaatccgcgcatccaggcgctgcgaaccgagcatcccgatctgtatgagttcgcc
tgctggctgcagtggatcgccgaggagcagctcgacgcggcccagcgtgccgcgcgcgac
gctggcatgtcgctcgggctcatgcaggacatggccgtgggcgtgcactcctacggtgcg
gacgcatggggcaacccggaacgcttcgccgtcggctccgtcacggtgggctgcccgccg
gacttctacaatcaacagggtcaggattggggccagcctccgctcaacccgaactatctc
gagctcaccggctaccgcatgtaccgcgagatggtgcaccacatgttcgaacatgcgggc
gccattcgcatcgaccacattctcggactgttccggctgtggtggatcccggccggccag
ggcgccaagggcggcgcatacgtcacctacaactacgatgcgatgatcgcggtgctcagc
atcgaggccacgcgtgtaaacggcatcgtgatcggcgaggatctcggcaccgtgcccgat
ttcgtgcgcaatgtgctcgcacgacacgggctgctcggcaccacggtggagtggttcgcc
cgcgtggacgactcccccaacgccggcgacccgtacgcgatgccgcagacgtaccgcaca
tactcactttcgtcggtcaccacacacgatctgccgccgaccgccggctatctcatgctc
gagcaggtcaaactgcgcgaggagctcggcctgctcaccgagccggtggaggagttccgc
gaatccgcgctcgccgaacggcaggccatgctcgacctgctcgtgcagggcggctggatg
agtcaggaggccgccgacgatgtgccggacaatctgcagaccattgtcgaggcgatgcac
gccatgctcaccgacgcgccttcgctgctgctgcaggccgcgctcgtggacggcgtgggc
gaggcgcgcgcgcagaaccagccggggacgtccacgcagtacccaaactggcgtattccg
ctcgccgacgagcatctcaaggtggtgcccacgcaggaggtgttcaagtcgccgcgcgtg
caggcgctggcgaagatcatgaaccgcattaatcagtag

DBGET integrated database retrieval system