KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_1558Help
Entry
BalV_1558         CDS       T01843                                 

Definition
dimethyladenosine transferase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BalV_1558
Enzymes [BR:blv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BalV_1558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1925172..1926128
Genome map
AA seq 318 aa AA seqDB search
MSAPNGARFQTPTLRADYASVHVDCPAKTNLTLHVGERREEWGGRHALETIYCGVGIYDT
VTVTAKEPGTGFSLDLAGTHLGDLAASTSDMRRNHAVLAMFAMAQASGHEPDVSISIEKR
IPVAAGLGGGSADAAGTLLALNALWNLNWPVARLREIAAALGADMPFCVTGGLALGTGFG
ERIKDLTASDPRIEHAVGDLFADAPSGDGVHMLVGAYLSQLSTPEVYSTFDVLGAGEGDL
NELQHAAVSLHPRSGVAIREAQQAGATSAFVSGSGPTVIAVVPDDRVREATRAAWQASGA
VDRIIDAQAPAAPLMRAE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacccaacggcgcccgattccagacccccacgctccgcgcagactacgccagc
gtgcatgtggactgccctgccaagacgaatctcacattgcatgtgggggaacgccgtgag
gaatggggcggcagacatgccttggagaccatctactgcggcgtgggtatctacgacacg
gtgacggtgaccgccaaggaaccgggcaccggcttctccctcgatctcgccggcactcat
ttgggagatctggccgcgtcgacgagcgatatgcgcaggaaccacgccgtgcttgccatg
ttcgcgatggcgcaggccagcgggcacgaacctgacgtctccattagcatagagaagcgc
attcccgtcgcagccggtctgggaggcgggtcggcggatgcggcgggcacactgctcgcg
ctcaatgcgttgtggaatctcaattggccggtggcacgactccgcgagatagcggccgcc
ttgggcgccgacatgccgttctgcgtcaccggcggcctggcgttgggcaccggcttcggc
gagcgtataaaggatctgaccgcatccgacccgcgtatcgaacatgcggtgggcgatctg
ttcgcagatgccccttccggcgatggcgtgcacatgctcgtcggcgcatacctgtcgcag
ctgagcacgccagaagtctactccaccttcgacgtgctcggcgcaggagaaggcgacctc
aacgagttgcagcacgccgccgtctcgctgcatccgcgcagcggcgtggccatccgcgaa
gctcagcaggcgggcgcgacgagtgccttcgtctccggatctggccctactgtaatcgcc
gtggtgcctgacgaccgggtgcgcgaggcgacgcgcgcggcatggcaggcttccggggcc
gtcgaccgcatcatcgatgcacaggcaccggccgcaccgctcatgcgagccgagtag

DBGET integrated database retrieval system