KEGG   Bifidobacterium animalis subsp. lactis B420: W7Y_0136Help
Entry
W7Y_0136          CDS       T02079                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
blw  Bifidobacterium animalis subsp. lactis B420
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:blw00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
154489..156009
Genome map
AA seq 506 aa AA seqDB search
MKNKVQLITYADRLGDGNLASMTDILRTRFDGVYEGVHILPFFTPFDGADAGFDPIDHTK
VDARLGDWDDIAELAKTHDIMVDAIVNHMSWQSKQFQDVLANGEDSEYYPMFLTMSSVFP
DGATEEELAGIYRPRPGLPFTHYSFAGKTRLVWVTFTPQQVDIDTDSAKGWEYLMSIFDQ
MSKSHVKYIRLDAVGYGAKEAGTSCFMTPKTFELISRLREEGAKRGLEILIEVHSYYKKQ
VEIAAKVDRVYDFALPPLLLHSLFTGKVDALAHWTEIRPNNAVTVLDTHDGIGVIDIGSD
QLDRSLKGLVPDADVDNMVETIAKNTHGESKAATGAAASNLDLYQVNSTYYSALGCNDQH
YIAARAVQFFLPGVPQVYYVGALAGENDMELLKRTNVGRDINRHYYTTSEIDKNLERPVV
KALNALARFRNELPAFDGDFSYSVGDDESIAFSWNGFGSSATLTFTPSKGMGVENPQSVA
TLVWTDSTGEHRTDDLIANPPVMQAS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaaagttcagctgatcacctatgcggatcgcttgggtgacggcaaccttgct
tcgatgaccgacattctgcgcacgcgattcgacggcgtgtacgagggcgtgcacattctg
ccgttcttcaccccgttcgatggcgcggacgcaggcttcgacccgatcgaccacaccaag
gtcgacgcccgcctcggtgactgggatgacatcgccgagctcgccaagacgcatgacatc
atggtcgatgccatcgtcaaccacatgagctggcagtccaagcagttccaggatgtgctc
gcgaacggcgaggattccgagtactacccgatgttcctcacgatgagctccgtgttcccc
gacggcgcgaccgaggaggagctcgccggcatctaccgcccgcgcccgggcctgccgttc
acccactacagcttcgccggcaagacccgcttggtgtgggtcacgttcacgccgcagcag
gtcgacattgacaccgactccgccaagggctgggaatacctgatgtcgatcttcgaccag
atgagcaagtcgcacgtcaagtacattcgcctcgacgccgtcggctacggcgccaaggag
gccggcaccagctgcttcatgacccccaagaccttcgaactcatctcgcgactgcgcgag
gagggtgccaagcgcggtctggagattctcatcgaggtgcactcgtactacaagaagcag
gtggagatcgccgccaaggtggatcgcgtctatgacttcgcgctgccgccattgctgctg
cactcgctgttcaccggcaaggtggacgcgctcgcgcactggaccgagattcgcccgaac
aatgcggtcaccgtgctcgacacgcacgacggcatcggcgtcatcgacatcggctccgac
cagctcgaccgttcgctcaagggtctggtgcccgacgcggacgtcgacaacatggtcgag
acgatcgcgaagaacacccatggcgagtcgaaggccgcaaccggcgccgccgcttcgaac
ctcgacctctaccaggtgaactccacatattattcggcgctcggctgcaatgaccagcat
tacattgccgcacgcgccgtgcagttcttcctgccgggcgttccgcaggtgtactatgtg
ggcgcgctcgccggcgagaacgacatggagctgctcaagcgcacgaatgtgggccgcgac
atcaaccgccactattacacgacctccgagatcgacaagaacctcgaacgtccggtggtc
aaggccctgaacgcgctcgccagattccgcaacgagctgccggcgttcgacggcgacttc
agctactcggtgggcgatgacgagtcgattgcgttctcctggaacggtttcggatcctcc
gctacgctcacgttcacgccgtccaagggcatgggtgtcgagaacccacagtccgtcgcc
acgctcgtctggacggattccactggcgagcaccgcaccgacgacctcattgcgaacccg
cccgtcatgcaggcgagctga

DBGET integrated database retrieval system