KEGG   Bifidobacterium animalis subsp. lactis B420: W7Y_0306Help
Entry
W7Y_0306          CDS       T02079                                 

Definition
Glutamate 5-kinase / RNA-binding C-terminal domain PUA (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
blw  Bifidobacterium animalis subsp. lactis B420
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:blw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    W7Y_0306
  Amino acid metabolism
   00330 Arginine and proline metabolism
    W7Y_0306
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    W7Y_0306
Enzymes [BR:blw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     W7Y_0306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
375246..376343
Genome map
AA seq 365 aa AA seqDB search
MAAARTVVVKVGSSSLTQPSGHLDVDKLNALVGAIAQVRMLGGNIVLVSSGAIAAGFGPL
GFESRPTDVATQQATASVGQGLLMAQYEMAFGRYGIRVGQLLITAEDTMQPRQYRNARRT
MAKLLELGVVPIVNENDALASNEIRFGDNDRLSALIANMVRADALILLTDVDALYTAPPS
EPGSHRIGFVPNITELLDQVRVGGSESGVGTGGMVTKLEAARMAAVSGIPAVLTAARNAG
PALMGDEVGTAFAPVKQRGSARRLWIKFAAHPRGVLVADSGAAKAVRGGRASLLAAGVLE
SRGDFAAGDPVWIDDEAGNHLARGLAGYDSEEIPNMLGRNTAQLRRLLGEEYAHPLVHRD
NLVLV
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtggcagccgcgcgaaccgtggtggtgaaggtggggtcgagctcgctcacgcagccgtcc
gggcacttggacgtagacaagctcaatgcgctggtgggcgcgatcgcgcaggtgcgcatg
ctcggcggcaacatcgtgctcgtctcgtccggcgccatcgccgcgggtttcggtccgctc
ggcttcgaatcgcgccccaccgatgtggccacacagcaggcgaccgcgtcggtggggcag
gggctgctcatggcccagtacgagatggcgttcggccgctacggcattcgcgtgggccag
ctgctcatcaccgccgaagacacgatgcagccacggcagtaccgcaatgcgcggcgcacc
atggccaagctgctcgaactcggtgtggtgccgatagtcaacgagaacgatgcgcttgcc
agcaacgagatccgtttcggcgacaacgaccggctttccgcgctcatcgcgaacatggtg
cgtgccgacgcgctgattctgctcaccgatgtcgacgcgctctacaccgcacccccaagc
gaaccgggctcccatagaatcggcttcgtgccgaacatcaccgaactgctcgatcaggtg
cgtgtgggcggttcagagtcgggcgtgggcaccggcggtatggtcacgaagctcgaggcc
gcgcgcatggccgccgtctccggcattccggccgtgctcaccgccgcccgcaacgccggt
ccggcactcatgggcgatgaggtgggcacggcattcgctccggtgaagcaacgcggttcg
gcgcgcaggttgtggatcaaattcgcggcccatccgcgtggagtgctcgtggccgattcc
ggcgcggccaaggcggtgcgcggcggacgggcgagtctgcttgctgcgggtgtgctcgaa
tcgcgtggtgatttcgccgccggcgacccggtgtggatcgacgacgaggcgggcaatcat
ctggcgcgcggccttgccggttacgattccgaggagattccgaatatgctcggacgcaac
accgcacagctgcgccgcctgcttggcgaggaatatgcgcacccgctcgtgcaccgcgac
aatctcgtgctcgtgtga

DBGET integrated database retrieval system