KEGG   Bifidobacterium animalis subsp. lactis B420: W7Y_0513Help
Entry
W7Y_0513          CDS       T02079                                 

Definition
Xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
blw  Bifidobacterium animalis subsp. lactis B420
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    W7Y_0513
   00051 Fructose and mannose metabolism
    W7Y_0513
Enzymes [BR:blw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     W7Y_0513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
604574..605926
Genome map
AA seq 450 aa AA seqDB search
MAGLWDIDKIEYVGRTKGLQEGLGFQYYDADKVVAGKKMKDWLRFGVAWWHTFDAPLTDP
FGDGTAQRPWDGKYSDPMDNALAKVDYAFEFFTKLGAEYFCFHDRDIAPEGDTLRETNAN
LDRVVDKIEENMQSTGVKLLWNTSSLFTNPRFVAGASTSPFADVYAYAAAQLKHSLEIGK
RLGAENYVFWGGREGYENLWVTDMKREQEHMAKFFHMCADYAKQIGMDAQFLIEPKAKEP
TTHQYDFDAATACNFLRAYDLIDVFKLNLEGNHANLAGHTYQHEIRVARDNGVLGSLDAN
QGDMLLGWDLDEFPTNLYETTSVMWEVLDEGQIGPHGGLNFDAKPRRTSFSAEDLFRAHI
AGMDSFAAGLLVADKMHQDKYIEDLVANRYGSYDSGIGKSIDDGTATLESLNDYAIDMPQ
SEIIASTHPDHLEDVKATINNYIIDALANA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtctgtgggacatcgacaagatcgagtatgtcggtcgcaccaaggggcttcag
gagggactcggcttccagtattatgacgccgacaaagtggtcgccggcaagaagatgaag
gactggctgcgcttcggcgtcgcatggtggcacaccttcgacgcgccgctcaccgacccc
ttcggtgacggcaccgcccagcgcccgtgggatggcaagtattccgacccgatggacaac
gcgctcgccaaggtggactacgcgttcgagttcttcaccaagctcggcgccgagtacttc
tgcttccatgaccgcgacatcgccccggaaggcgatacgctgcgcgagacgaacgccaac
ctcgaccgcgtggtcgacaagatcgaagagaacatgcagtccaccggcgtgaagctgctg
tggaacacctcgtcgctcttcaccaacccgcgcttcgtggcgggcgcctccacctcgccg
ttcgccgacgtctacgcctatgccgcggcgcagctcaagcactccctcgagatcggcaag
cgcctgggcgccgagaactacgtgttctggggcggccgcgaaggctacgagaacctgtgg
gtcaccgacatgaagcgtgagcaggagcacatggcgaagttcttccacatgtgcgccgac
tacgccaagcagatcggcatggacgcccagttcctcatcgagccgaaggccaaggaaccg
acgacgcaccagtacgacttcgacgcggccacggcatgcaacttcctgcgcgcctatgac
ctgatcgacgtcttcaagctcaacctcgaaggcaaccacgcgaacctcgccggccacacc
taccagcacgagatccgtgtcgcgcgtgacaacggcgtgctcggttcgctcgacgccaac
cagggcgacatgctgcttggctgggatctcgacgagttcccgaccaacctgtacgagacc
acctccgtgatgtgggaagtgctcgatgaaggccagatcggccctcacggcggcctcaac
ttcgatgccaagccgcgccgcacctcgttcagcgccgaagacctgttccgcgcgcacatc
gccggcatggactcgttcgccgccggcctgctcgtggcagacaagatgcatcaggacaag
tacatcgaggacctcgtggccaatcgttacggctcctacgattcgggcatcggtaagtcg
atcgacgacggcaccgcgaccctcgaatcgctcaacgactacgccatcgacatgccgcag
tccgagatcatcgcatccacgcaccccgatcacctcgaggacgtgaaggcgaccatcaac
aactacatcatcgacgccctggccaacgcctga

DBGET integrated database retrieval system