KEGG   Bifidobacterium animalis subsp. lactis B420: W7Y_0849Help
Entry
W7Y_0849          CDS       T02079                                 

Definition
hypothetical protein
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
blw  Bifidobacterium animalis subsp. lactis B420
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blw00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    W7Y_0849
   01230 Biosynthesis of amino acids
    W7Y_0849
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    W7Y_0849
   00290 Valine, leucine and isoleucine biosynthesis
    W7Y_0849
Enzymes [BR:blw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     W7Y_0849
    2.6.1.66  valine---pyruvate transaminase
     W7Y_0849
Amino acid related enzymes [BR:blw01007]
 Aminotransferase (transaminase)
  Class I
   W7Y_0849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(971306..972985)
Genome map
AA seq 559 aa AA seqDB search
MTDFTTRLNQAMELRNIKQIDFVKAAQDHGVKLGRSHISQYVSGKTRPRRDIERFLAAVL
RVNADWLAGESVPFDDDPETFAKIEHVSPDADFEHIKRVEQNSSIQNSEHIEHNNELAEI
EQEQDMEAAANNNVQDPSFPDVPSSVTSEPMNIGSRRVFTKSHKLDNVLYDVRGPVVNEA
ARMEAAGMHVMKLNIGNPAPFGFRTPDEVVYDMAQQLTDTEGYSASKGLFSARKAIMQYA
QLKNLPNVGVEDIYTGNGVSELINLSMSALLDDGDEVLLPAPDYPLWTACVTLAGGKPVH
YVCDEQSEWYPDIDDMRAKITDRTKAIVIINPNNPTGALYPTEVLQQIVELARQHQLMIF
SDEIYDRLVMDGLTHTSIASLAPDLFCVTYSGLSKSHMIAGYRIGWMILSGNKSIAKDYI
EGLDMLTNMRICSNVPAQSIVQTALGGHQSVNDYLVPGGRIYEQREYIYNALNSIDGITA
VKPKAAFYIFPKIDAKKFNIRNDEQFALDLLHDEKLLIVQGTGFNWKDPDHFRVVYLPRV
EVLKGAVDKMTHFFSHYRQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttcaccacgcgcctcaatcaggcgatggagttgcgcaacatcaagcagatc
gacttcgtcaaagcggcgcaggaccatggagtcaagctggggcgcagccacatcagtcaa
tatgtgagcggcaaaacaagaccgcgccgcgatattgagcgattcctcgcggctgtgttg
cgggtgaacgcggattggctggcaggcgagagcgtgccgttcgacgatgatcctgaaacc
ttcgcaaagattgaacacgtgagtccagacgccgattttgaacatatcaagagagttgaa
cagaatagttcgattcagaattctgaacatattgaacataacaatgaactcgctgaaatt
gaacaggagcaagacatggaagcggcagcgaacaataatgtgcaggacccctcgttccct
gatgtgccatcaagtgtcacatcggaacccatgaacatcggctcccgacgggtcttcacc
aagtcacataaactggacaacgtgctctatgacgtacgcggaccggtggtcaacgaggcg
gcgcgcatggaagcagccggcatgcatgtgatgaaactcaatataggcaatccagcccca
ttcggattccgtacaccggacgaagtcgtctatgacatggcacaacagctcaccgatacg
gaagggtattcggcgtcaaaggggctcttctcagcccgtaaggcgatcatgcagtacgct
cagctcaagaacctgccgaatgtgggagtagaagacatctacactggcaacggtgtgagc
gagctcatcaacctcagcatgagtgcgttgttggacgacggggacgaagtgctgctaccg
gcccccgactatccgttgtggacggcatgcgtcaccctggcaggcggcaaaccagtgcat
tacgtctgcgacgaacagtcggagtggtatccggacatcgacgatatgcgtgccaagatc
accgatcgcaccaaggcaatcgtcatcatcaacccgaacaatccgacaggcgcgctctat
ccgaccgaggtgctgcagcagatcgtcgaactggcgcggcagcaccagcttatgatcttc
tccgacgagatctatgaccgcctcgtcatggatgggctcacccacacgtcaatcgcctcc
ctcgcccccgacctgttctgcgtgacctatagcggtttgtcgaagtctcatatgatcgcc
gggtaccgcatcggctggatgatcctgtcaggcaacaagtcgatcgcgaaggattacatc
gaaggccttgacatgctcacgaacatgcgcatctgctcgaatgtacccgcccaatcaatc
gtgcagacggcattgggaggccatcagagtgtcaacgactacctcgttccggggggccgt
atatacgaacagcgtgaatacatctacaacgcgctgaactcaatcgatggcatcacggcg
gtcaaaccgaaggcggccttctacatcttcccgaaaatcgatgcgaagaaattcaacatt
cgcaacgacgagcaattcgcgctcgatctgctgcacgacgagaaactgctcatcgtgcag
ggcaccggtttcaattggaaggacccggaccatttccgtgtggtctacctgccgcgcgtc
gaggtgctcaaaggcgccgtcgacaaaatgacacacttcttcagccactatcgccaatag

DBGET integrated database retrieval system