KEGG   Bifidobacterium animalis subsp. lactis B420: W7Y_0849Help
Entry
W7Y_0849          CDS       T02079                                 

Definition
hypothetical protein
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
blw  Bifidobacterium animalis subsp. lactis B420
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:blw01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:blw01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:blw00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:blw00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(971306..972985)
Genome map
AA seq 559 aa AA seqDB search
MTDFTTRLNQAMELRNIKQIDFVKAAQDHGVKLGRSHISQYVSGKTRPRRDIERFLAAVL
RVNADWLAGESVPFDDDPETFAKIEHVSPDADFEHIKRVEQNSSIQNSEHIEHNNELAEI
EQEQDMEAAANNNVQDPSFPDVPSSVTSEPMNIGSRRVFTKSHKLDNVLYDVRGPVVNEA
ARMEAAGMHVMKLNIGNPAPFGFRTPDEVVYDMAQQLTDTEGYSASKGLFSARKAIMQYA
QLKNLPNVGVEDIYTGNGVSELINLSMSALLDDGDEVLLPAPDYPLWTACVTLAGGKPVH
YVCDEQSEWYPDIDDMRAKITDRTKAIVIINPNNPTGALYPTEVLQQIVELARQHQLMIF
SDEIYDRLVMDGLTHTSIASLAPDLFCVTYSGLSKSHMIAGYRIGWMILSGNKSIAKDYI
EGLDMLTNMRICSNVPAQSIVQTALGGHQSVNDYLVPGGRIYEQREYIYNALNSIDGITA
VKPKAAFYIFPKIDAKKFNIRNDEQFALDLLHDEKLLIVQGTGFNWKDPDHFRVVYLPRV
EVLKGAVDKMTHFFSHYRQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttcaccacgcgcctcaatcaggcgatggagttgcgcaacatcaagcagatc
gacttcgtcaaagcggcgcaggaccatggagtcaagctggggcgcagccacatcagtcaa
tatgtgagcggcaaaacaagaccgcgccgcgatattgagcgattcctcgcggctgtgttg
cgggtgaacgcggattggctggcaggcgagagcgtgccgttcgacgatgatcctgaaacc
ttcgcaaagattgaacacgtgagtccagacgccgattttgaacatatcaagagagttgaa
cagaatagttcgattcagaattctgaacatattgaacataacaatgaactcgctgaaatt
gaacaggagcaagacatggaagcggcagcgaacaataatgtgcaggacccctcgttccct
gatgtgccatcaagtgtcacatcggaacccatgaacatcggctcccgacgggtcttcacc
aagtcacataaactggacaacgtgctctatgacgtacgcggaccggtggtcaacgaggcg
gcgcgcatggaagcagccggcatgcatgtgatgaaactcaatataggcaatccagcccca
ttcggattccgtacaccggacgaagtcgtctatgacatggcacaacagctcaccgatacg
gaagggtattcggcgtcaaaggggctcttctcagcccgtaaggcgatcatgcagtacgct
cagctcaagaacctgccgaatgtgggagtagaagacatctacactggcaacggtgtgagc
gagctcatcaacctcagcatgagtgcgttgttggacgacggggacgaagtgctgctaccg
gcccccgactatccgttgtggacggcatgcgtcaccctggcaggcggcaaaccagtgcat
tacgtctgcgacgaacagtcggagtggtatccggacatcgacgatatgcgtgccaagatc
accgatcgcaccaaggcaatcgtcatcatcaacccgaacaatccgacaggcgcgctctat
ccgaccgaggtgctgcagcagatcgtcgaactggcgcggcagcaccagcttatgatcttc
tccgacgagatctatgaccgcctcgtcatggatgggctcacccacacgtcaatcgcctcc
ctcgcccccgacctgttctgcgtgacctatagcggtttgtcgaagtctcatatgatcgcc
gggtaccgcatcggctggatgatcctgtcaggcaacaagtcgatcgcgaaggattacatc
gaaggccttgacatgctcacgaacatgcgcatctgctcgaatgtacccgcccaatcaatc
gtgcagacggcattgggaggccatcagagtgtcaacgactacctcgttccggggggccgt
atatacgaacagcgtgaatacatctacaacgcgctgaactcaatcgatggcatcacggcg
gtcaaaccgaaggcggccttctacatcttcccgaaaatcgatgcgaagaaattcaacatt
cgcaacgacgagcaattcgcgctcgatctgctgcacgacgagaaactgctcatcgtgcag
ggcaccggtttcaattggaaggacccggaccatttccgtgtggtctacctgccgcgcgtc
gaggtgctcaaaggcgccgtcgacaaaatgacacacttcttcagccactatcgccaatag

DBGET integrated database retrieval system