KEGG   Bifidobacterium animalis subsp. lactis B420: W7Y_1416Help
Entry
W7Y_1416          CDS       T02079                                 

Definition
glucosylceramidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
blw  Bifidobacterium animalis subsp. lactis B420
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:blw00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:blw00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1667327..1668781)
Genome map
AA seq 484 aa AA seqDB search
MIQAFSTYANAQGTTLAAAFAPLGNAYLRVGRTPESTSHASTPTLSIDTTRVRQPIDGFG
ASITEATSWLWHNRVTDKERCIRDLFSPRDGIGISMLRQPIGPSDHVSAPYRFVRRFPDR
NLNSLDFTPEMERVLPMVEAANDCALATQSHALNIMASPWSAPWWMKTNLSVLGKRRYTR
ITGHLRRGMYAAYARYITGFARLYAQRGLPLFALTVTNEPDYPQSRWPSMAMTPREQAEF
VARHLRPMLDHAGLEGTRILCWDHNYSTDHYPDGAFVRDMYADSAALTACAGSAWHYYGG
SARTMSRIHDAFPNKGIWATEASGGDWGPRNFTPALLSLGTAVIDMMNNWARSAVLWNIA
LDEHGGPDYYYLRNDRRHSENRGLITVRDDGSIRRNADYYALGHFSKYVPIGSRCVECAL
DHAQGVRAAAFLVPAALTHGDGDQVVAVLVNSRPEPLDLLCHLRGAGNGVMLTLPASSLT
SFLA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgattcaggcattctcaacatacgcgaatgcgcagggcaccacgcttgccgccgcgttc
gcgccgcttgggaatgcctatttgcgtgtagggcgcacgccggagagcacgtcacacgcc
agcacccccacgctcagcatcgacacgactcgcgtgcgccagcccatcgacggcttcggc
gcatcgatcaccgaggcgacgagctggctgtggcacaatcgcgtcacagacaaagagcga
tgcatccgcgatctgttcagcccgcgcgacggcataggcatctcgatgctccgtcagcca
atcggcccaagcgaccatgtgagcgcgccgtaccgcttcgtgcgcagattccccgaccgc
aatctcaactccctcgatttcacacccgagatggagcgcgtgttgcccatggtcgaggcc
gcgaacgactgtgcgctcgccacgcaatcgcatgcgctcaacattatggcgagcccgtgg
agcgcgccatggtggatgaaaacgaatctcagcgtgctcggcaaacggcgctacacgcgg
atcaccggccatctgcggcgcggcatgtatgccgcctatgcgcgctatatcaccggtttt
gcgcgattgtatgcgcagcgcggactgccgctgttcgcgctcaccgtgacgaacgaaccc
gactacccgcagtcgcgatggccatcgatggcaatgaccccgcgcgagcaggcagagttc
gtcgcgcgccatctgcgccccatgctcgaccacgccggattggaaggcacgcgcattctg
tgctgggaccacaactactccaccgaccattatccggacggcgccttcgtgcgagacatg
tacgccgattccgccgcgctcaccgcctgcgccggctccgcatggcattattacggcgga
tccgcgcgcacgatgtctcgcattcacgacgcgtttccgaacaagggcatctgggcgacc
gaggcgagcggcggcgactgggggccgcgcaatttcacacccgcgctgctctcgctgggc
acggcggtcattgacatgatgaacaactgggcgaggagcgccgtgttgtggaacatcgcg
ctcgacgagcacggcggtcccgactactactacctgcgcaacgatcgccggcattccgag
aaccgtggtctgatcactgtgcgtgacgacggttcgatacgccgcaatgcagactactac
gcgctcggccacttctccaaatacgtgccgattggctcacgttgcgtggaatgcgcgctc
gaccatgcgcaaggtgtgcgtgccgccgccttcctagtccctgccgctcttactcatggt
gatggtgaccaggttgttgccgtgctcgtgaactctcgccccgagccgctcgacctgctg
tgccatctgcgcggtgcaggcaacggcgtgatgctgacattgccggcttcctccctcacc
tctttcctggcatga

DBGET integrated database retrieval system