KEGG   Bifidobacterium animalis subsp. lactis B420: W7Y_1496Help
Entry
W7Y_1496          CDS       T02079                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
blw  Bifidobacterium animalis subsp. lactis B420
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:blw00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    W7Y_1496
Enzymes [BR:blw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     W7Y_1496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1760892..1761860)
Genome map
AA seq 322 aa AA seqDB search
MNQILDKLEQIHGSVSVVGSMNADYTVTTERLPGPGETVTGGPLQVLPGGKSGNQAAAAA
KLGATVRMFGAVGSDSNADFLLTQLASAGVNTDGIRKVLGPSGTTVITVDSHGENTIVYS
PGSNANVTVEYIESQRDLLTASSVLGLCLESPLETVTACATMCHDAGMKVLLNDSPFIAT
LPSELIAHADILLVNEHELVQLLHIDEPEDDDWDSFDWAQAQNRLSEFGFDQAIVTLGGD
GSVVLDSTVDPSIIRIAPVRVDAVDTTGCGDSFMGTVLASLASGLSLEESAQLASYVSAY
AATGYGAQASYGTAAQIRERFR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagattctcgataagctggagcagattcacggatccgtctccgtggtcggttcg
atgaacgcagattacacggtgaccaccgagcggctccccgggccgggggagaccgtgacc
ggcggcccgctacaggtgctgcccggtggcaaatcgggcaatcaggccgccgctgccgcc
aagctcggcgccaccgtgcgcatgttcggtgcagtgggctccgactcgaatgcggatttc
ctgctgactcagctcgcatccgccggagtgaacaccgatggcattcgcaaggtgctcggc
cccagcggcacgacggtgatcactgtggattcccatggcgagaacaccattgtgtattcg
ccgggttccaacgcgaacgtgacggtggaatacatcgaatcccagcgcgatctgcttacc
gcatcgtcggtgctgggactgtgtttggaaagcccgcttgaaacagtgaccgcatgcgcg
accatgtgccatgatgcgggtatgaaggtgctgctcaacgattcgcccttcattgcgacg
ttgccgtccgaactcattgcgcatgccgacattctgctggtcaatgagcatgagctcgtg
cagctgctgcacattgacgagcctgaagatgatgactgggattcgttcgattgggcacag
gctcagaaccgtttgagcgagttcggttttgatcaggcgattgtgacgcttggcggcgac
ggttcggtggtgcttgactccacggtggatccatcgatcatccgcattgccccggtgcgt
gtggatgcggtggataccacgggctgcggcgattcgttcatgggcactgtgctggcttca
ttggccagtggactgagcttggaggagtccgcgcaactggcttcgtatgtgtcggcatat
gcggccaccggctatggtgcgcaggcctcctatggcaccgccgcgcagattcgggagcgc
ttccgctaa

DBGET integrated database retrieval system