KEGG   Burkholderia mallei ATCC 23344: BMA0234Help
Entry
BMA0234           CDS       T00204                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bma00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1:complement(251739..253271)
Genome map
AA seq 510 aa AA seqDB search
MCGIGAIFSTQRASVDGIERSLSALMSKIAHRGDASRFNENLIRERFGLATNRLAIVERD
HARQPVSDHERDLHVVLNGQIYNYKELRDELAARGHRFSHAGDAEVLLRAYLEYGPSFAT
KLDGMFSFVLFDNLNGKFLIGRDHVGIKPLYYAQRDGVWYVASELKALTHVNARIETLAP
GTLFDGKETIRYVSYDASRPVSRDSFDEAKARVRTPLEESVRRRVDTDLPICVMFSGGID
SAIVLRLAHRYHPDVTAISFGLPGSNDIEIAHRYCAEHGIRHVIYTFTKQDLLENIDDAV
YYGEFFEKIDAIDSAIAHFGYYIANKLGLKVALCGEGSDEIFGGYDLFKTHAQPGALSLY
RLNNLHRTDLQRVDRASMRNTVEARVPFMDAELIDYVLSLDFSYKLHGGVEKHILREAFR
DVLPGYIIDRPKIRMPDGSGVKNVIIDHIDSLGDAPPDDAARRLGEIGLSDRSALFFARK
YLECNFPFPTQRFKQAGKDFSESGYFDFIS
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattggggccattttcagcacgcagcgcgcgtcggtcgacggcatcgagcgc
tcgctgagcgcgttgatgtcgaagatcgcgcaccgcggcgacgcgtcgcgcttcaacgaa
aacctgatccgggagcgcttcggcctcgcgacgaaccgcctcgcgatcgtcgagcgcgac
catgcgcgccaaccggtgtccgatcacgagcgcgacctgcacgtcgtgctcaacgggcag
atctacaactacaaggaactgcgcgacgagctcgccgcgcgcggccaccgcttcagccat
gcgggcgacgccgaggtgctgttgcgcgcgtacctcgagtacggcccgtcgttcgcgacg
aagctcgacggcatgttcagcttcgtgctgttcgacaacctgaacggaaaattcctgatc
gggcgcgaccacgtcggcatcaagccgctctattacgcgcagcgcgacggcgtctggtac
gtcgcgtcggaactcaaggcgctcacgcacgtgaacgcgcgaatcgagacgctcgcgccc
ggcacgctgttcgacggcaaggagacgatcaggtacgtgtcgtacgacgccagccgcccg
gtgagccgcgacagcttcgacgaagcgaaggcgcgcgtgcgcacgccgctcgaggaatcg
gtgcgccgccgcgtcgacaccgacctgccgatctgcgtgatgttcagcggcggcatcgac
agcgcgatcgtgctgcggctcgcgcaccgctatcacccggacgtgaccgcgatctcgttc
ggcctgcccggctcgaacgacatcgagatcgcgcaccgctactgcgccgagcacggcatc
cgccacgtgatctacacgttcacgaagcaggacctgctcgagaacatcgacgacgcggtc
tattacggcgaattcttcgagaagatcgacgcgatcgattcggcgatcgcgcatttcggc
tactacatcgcgaacaagctcggcttgaaggttgcgctctgcggcgaaggcagcgacgag
atcttcggcggctacgatctgttcaagacgcacgcgcagcccggcgcgctgtcgctctat
cggctcaacaacctgcaccgtaccgatctgcagcgcgtcgatcgcgcgagcatgcgcaat
acggtcgaggcgcgggtgccgttcatggacgccgagctgatcgactacgtgctgagcctc
gacttctcgtacaaactgcacggcggcgtcgaaaagcatatcctgcgcgaggcgtttcgc
gacgtgctgccgggctacatcatcgatcgcccgaaaatcaggatgcccgacggcagcggc
gtgaagaacgtcatcatcgaccacatcgacagcctcggcgacgcgccgcctgacgatgcg
gcaaggcggctcggcgaaatcgggctgtccgaccgctcggcgctcttcttcgcgcggaag
tacctggagtgcaacttcccgtttccgacgcagcgcttcaagcaggccggcaaggatttt
tcggaatccggatatttcgacttcatctcatga

DBGET integrated database retrieval system