KEGG   Burkholderia mallei ATCC 23344: BMA0240Help
Entry
BMA0240           CDS       T00204                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bma00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BMA0240 (glpK)
Enzymes [BR:bma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BMA0240 (glpK)
Exosome [BR:bma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMA0240 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(258206..259717)
Genome map
AA seq 503 aa AA seqDB search
MRQMQDQYILALDQGTTSSRAMLFDRQGNIVSIAQKEFEQIYPQPGWVEHDPQEIWSTQA
GVAAEAVTRVGLNGTAIAAIGITNQRETTIVWDRETGHPIYNAIVWQDRRTADFCDKLKA
QGLSEKVRAKTGLPIDSYFSATKIRWILDNVEGAREKARQGKLAFGTVDSWLVWNFTKHE
LHVTDVTNASRTMLFNIHTLDWDDELLDALEIPRSMLPQVRASSEIYGPTKTTVFASKIP
LAGIAGDQQAALFGQMCTSSGMVKNTYGTGCFLMMNTGETPIESRNNLVTTIAWQVDGKV
SYALEGSIFIAGAVVQWLRDGLGIIKSASEIEALAAGVPHTDGVYLVPAFAGLGAPHWNA
RARGSLFGVTRGTTSAHLARAALDSIAYQSLDVLKAMEADSGIRIGELRVDGGASANNLL
MQFQADLLGVDAVRPRITETTALGAAYLAGLAIGYWQNVDELHSQWQLERRFAPSMQAEQ
VGSCLAGWQRAVRAAKAWADDTQ
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagacagatgcaggaccagtacatcctcgcgctcgaccagggcacgaccagctcccgc
gccatgctgttcgatcgacaaggcaacatcgtatcgatcgcgcagaaggaattcgagcaa
atttatccgcagccgggctgggtcgagcacgatccccaggagatctggtcgacgcaggcg
ggcgtcgcggccgaggccgtcacgcgcgtcggcctgaacggcacggcgatcgccgcgatc
ggcatcacgaaccagcgcgagacgacgatcgtctgggatcgcgagacgggtcatccgatc
tacaacgcgatcgtctggcaggatcgccgcaccgccgatttctgcgacaagctcaaggcg
cagggcctcagcgagaaggtgcgcgcgaagacgggcctgccgatcgactcgtacttctcg
gccaccaagatccgctggattctcgacaacgtcgagggcgcgcgcgagaaggcgcgccag
ggcaagctcgcgttcggcacggtcgacagctggctcgtgtggaacttcacgaagcacgag
ctgcacgtgaccgacgtgacgaacgcgtcgcgcacgatgctcttcaacatccacacgctc
gactgggacgacgagttgctcgacgcactcgagattccgcgcagcatgctgccgcaagtg
cgcgcgtcctccgagatctacgggccgacgaagaccaccgtgttcgcctcgaagattccg
ctcgccggcatcgcgggcgatcagcaggccgcgctcttcggccagatgtgcacgagctcg
ggcatggtgaagaacacctacggcaccggctgcttcctgatgatgaacaccggcgagacg
ccgatcgaatcgcggaacaacctcgtcacgacgatcgcctggcaagtcgacggcaaggtc
agctacgcgctcgaaggcagcatcttcatcgcgggcgcggtcgtgcagtggctgcgcgac
gggctcggcatcatcaagagcgcgtcggagatcgaggcgctcgccgccggcgtgccgcac
acggacggcgtctatctcgtgcccgcgttcgccggcctcggcgcgccgcactggaacgcg
cgcgcccgcggctcgctgttcggcgtcacgcgcggcacgacgtccgcgcacctcgcgcgc
gcggcgctcgattcgatcgcgtatcaatcgctcgacgtgctcaaggccatggaggccgat
tcgggcatccgcatcggcgagctgcgcgtggacggcggcgcgagcgcgaacaacctgctg
atgcagttccaggcggatctgctcggcgtcgacgcggtgcgcccgcgcatcaccgagacg
accgcgctcggcgccgcgtatctcgcgggcctcgcgatcggctactggcagaacgtcgac
gagctgcacagccaatggcagctcgagcgccgcttcgcgccttcgatgcaggccgagcag
gtgggctcttgcctcgccggctggcagcgcgcggtgcgcgcggcgaaggcatgggcggac
gacacgcagtaa

DBGET integrated database retrieval system