KEGG   Burkholderia mallei ATCC 23344: BMA0673Help
Entry
BMA0673           CDS       T00204                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bma  Burkholderia mallei ATCC 23344
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bma00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bma00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:bma03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:bma03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bma03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1:697308..697724
Genome map
AA seq 138 aa AA seqDB search
MTRIDFHTNVGDSLAYACRLLRKAYQAGQPVVVCAEPARLRALDERLWTFSPLDFIPHCA
IDNAHAASTPIVLTADLERAPHHGILLNLGAQVPAQFARFERLLEVVGNPPDELAAGRDR
YRFYRDRGYALNNHKQGG
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggatcgatttccatacgaatgtcggcgattcgctcgcgtacgcgtgccggctg
ctgcgcaaggcgtatcaggcggggcagcccgtcgtcgtgtgcgcggagcccgcgcggctg
cgcgcgctcgacgagcgtctgtggacgttctcgccgctcgatttcattccgcattgcgcg
atcgacaacgcgcacgcggcgagcacgccgatcgtgctgaccgcggatctcgagcgcgcg
ccgcatcacgggatcctgctgaacctgggcgcgcaggtgccggcgcagttcgcacgcttc
gagcgcctgctcgaggtggtcggcaacccgcccgacgagctcgcggccggccgcgaccgg
tatcggttctatcgcgatcgcggctacgcgctcaacaatcacaagcagggcggctag

DBGET integrated database retrieval system